Contact Molecules for Homologous Proteins | ||||
![]() [Summary Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2634797 | 165 | 84 | P05161(ISG15_HUMAN) | RecName: Full=Ubiquitin-like protein ISG15;AltName: Full=Interferon-induced 15 kDa protein;AltName: Full=Interferon-induced 17 kDa protein; Short=IP17;AltName: Full=Ubiquitin cross-reactive protein; Short=hUCRP;Flags: Precursor; |
QUERYSEQ |
MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFM NLRLRGGGTEPGGRS |
165 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
region | name | description |
![]() ![]() ![]() |
2-157 | CHAIN | /note="Ubiquitin-like protein ISG15" /id="PRO_0000035986" |
![]() ![]() |
158-165 | PROPEP | /note="Removed in mature form" /id="PRO_0000035987" |
![]() ![]() ![]() |
2-78 | DOMAIN | /note="Ubiquitin-like 1" |
![]() ![]() ![]() |
79-157 | DOMAIN | /note="Ubiquitin-like 2" |
![]() ![]() ![]() |
153-157 | REGION | /note="Involved in the ligation of specific target proteins" |
![]() ![]() ![]() |
1-165 | DISORDER | predicted by DISOPRED |
![]() |
|||||||
165 | |||||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
pdb_id | a1 | identity[%]2 | description | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 99.3 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 99.3 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 99.3 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 99.3 | UCRP_HUMAN interferon, alpha-inducible protein (clone IFI-15K) | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 98.7 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 70.4 | E2R7R1_CANLF ISG15 ubiquitin-like modifier | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 70.4 | E2R7R1_CANLF ISG15 ubiquitin-like modifier | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 66.5 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | 65.6 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | 65.6 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 65.6 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 65.6 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 65.4 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 65.4 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 65.3 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 64.9 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 64.7 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | 64.7 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 64.7 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | 64.7 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 64.7 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | 64.7 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 64.7 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | 64.7 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 64.7 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 65.1 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 64.5 | Q9GKP4_SHEEP Interferon stimulated gene 17 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 64.7 | Q9GKP4_SHEEP Interferon stimulated gene 17 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 64.4 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I | 64.4 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J | 64.4 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 64.4 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | 65.3 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 65.3 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | 65.5 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J | 66.2 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 98.8 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I | 66.7 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 65.1 | ISG15_BOVIN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 65.1 | ISG15_BOVIN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 60.4 | L5LC70_MYODS Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | ISG15_HUMAN ISG15 CTD-propargylamide | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | ISG15_HUMAN ISG15 CTD-propargylamide | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | 100.0 | ISG15_HUMAN ISG15 CTD-propargylamide | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | 65.0 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 100.0 | UCRP_HUMAN Interferon-induced 17 kDa protein | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | 73.3 | Q9GKP4_SHEEP Interferon stimulated gene 17 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 73.3 | Q9GKP4_SHEEP Interferon stimulated gene 17 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 73.3 | Q9GKP4_SHEEP Interferon stimulated gene 17 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | 73.3 | Q9GKP4_SHEEP Interferon stimulated gene 17 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 64.5 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 64.5 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 64.5 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 64.5 | ISG15_MOUSE Ubiquitin-like protein ISG15 | |||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
![]() |
|||||||
165 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | POLG_FMDVO Lbpro[156 aa] | B | 100.0 /100.0 |
9 /10 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 3[313 aa] | B | 100.0 /100.0 |
11 /12 |
ISG15_HUMAN ISG15 CTD-propargylamide |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 3[313 aa] | D | 100.0 /100.0 |
13 /14 |
ISG15_HUMAN ISG15 CTD-propargylamide |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Non-structural protein 3[307 aa] | F | 100.0 /100.0 |
12 /13 |
ISG15_HUMAN ISG15 CTD-propargylamide |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1A_SARS2 Replicase polyprotein 1a[283 aa] | B | 68.0 /66.5 |
25 /25 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1A_SARS2 Papain-like protease[312 aa] | B | 100.0 /100.0 |
22 /23 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1A_SARS2 Papain-like protease[313 aa] | D | 100.0 /100.0 |
24 /24 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1A_SARS2 Papain-like protease[313 aa] | F | 100.0 /100.0 |
24 /25 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | R1A_SARS2 Papain-like protease[313 aa] | H | 100.0 /100.0 |
24 /25 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I | R1A_SARS2 Papain-like protease[313 aa] | J | 100.0 /100.0 |
24 /25 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7[704 aa.. | B | 100.0 /100.0 |
17 /17 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7[989 aa.. | B | 100.0 /100.0 |
26 /26 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7[989 aa.. | D | 100.0 /100.0 |
9 /9 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7[992 aa.. | B | 100.0 /100.0 |
25 /25 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7[992 aa.. | D | 100.0 /100.0 |
12 /12 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7[989 aa.. | B | 100.0 /98.8 |
20 /20 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7[992 aa.. | B | 100.0 /100.0 |
25 /25 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7[992 aa.. | D | 100.0 /100.0 |
10 /10 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | UB2L6_HUMAN Ubiquitin/ISG15-conjugating enzyme E2 L6[152 aa] | D | 100.0 /100.0 |
3 /3 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | UB2L6_HUMAN Ubiquitin/ISG15-conjugating enzyme E2 L6[152 aa] | D | 100.0 /100.0 |
4 /4 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | UB2L6_HUMAN Ubiquitin/ISG15-conjugating enzyme E2 L6[152 aa] | D | 100.0 /100.0 |
3 /3 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | K0BWD0_9BETC ORF1ab[319 aa] | A | 100.0 /100.0 |
17 /17 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | K0BWD0_9BETC ORF1ab[319 aa] | C | 100.0 /100.0 |
16 /16 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | K0BWD0_9BETC ORF1ab[319 aa] | B | 100.0 /100.0 |
15 /15 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | K0BWD0_9BETC ORF1ab[319 aa] | D | 100.0 /100.0 |
15 /15 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | K4LC41_9BETC ORF1a[259 aa] | C | 100.0 /99.3 |
17 /17 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | K4LC41_9BETC ORF1a[259 aa] | D | 100.0 /99.3 |
15 /15 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | L_CCHFI RNA-directed RNA polymerase L[162 aa] | B | 100.0 /100.0 |
19 /19 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | L_CCHFI RNA-directed RNA polymerase L[162 aa] | B | 100.0 /100.0 |
2 /2 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | Q6TQF5_9VIRU RNA polymerase[164 aa] | B | 100.0 /98.7 |
15 /15 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | B8PWH5_9VIRU RNA-dependent RNA polymerase[158 aa] | B | 78.9 /73.3 |
19 /19 |
Q9GKP4_SHEEP Interferon stimulated gene 17 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | B8PWH5_9VIRU RNA-dependent RNA polymerase[157 aa] | D | 81.2 /73.3 |
16 /16 |
Q9GKP4_SHEEP Interferon stimulated gene 17 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | B8PWH5_9VIRU RNA-dependent RNA polymerase[157 aa] | F | 78.9 /73.3 |
19 /19 |
Q9GKP4_SHEEP Interferon stimulated gene 17 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | B8PWH5_9VIRU RNA-dependent RNA polymerase[158 aa] | H | 82.4 /73.3 |
17 /17 |
Q9GKP4_SHEEP Interferon stimulated gene 17 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | UBP18_MOUSE Ubl carboxyl-terminal hydrolase 18[304 aa] | B | 58.1 /65.4 |
31 /32 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | UBP18_MOUSE Ubl carboxyl-terminal hydrolase 18[300 aa] | D | 64.5 /65.4 |
31 /32 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | NS1_INBLE Non-structural protein 1[96 aa] | C | 100.0 /100.0 |
11 /11 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | NS1_INBLE Non-structural protein 1[96 aa] | C | 100.0 /100.0 |
7 /7 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | NS1_INBLE Non-structural protein 1[96 aa] | D | 100.0 /100.0 |
8 /8 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | NS1_INBLE Non-structural protein 1[96 aa] | D | 100.0 /100.0 |
9 /9 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | NS1_INBLE Non-structural protein 1[94 aa] | A | 87.5 /99.3 |
8 /8 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | NS1_INBLE Non-structural protein 1[94 aa] | A | 100.0 /99.3 |
15 /15 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | NS1_INBLE Non-structural protein 1[94 aa] | A | 100.0 /99.3 |
15 /15 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | NS1_INBLE Non-structural protein 1[94 aa] | A | 87.5 /99.3 |
8 /8 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | NS1_INBLE Non-structural protein 1[95 aa] | C | 100.0 /100.0 |
13 /13 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | NS1_INBLE Non-structural protein 1[97 aa] | C | 100.0 /100.0 |
10 /10 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | NS1_INBLE Non-structural protein 1[95 aa] | D | 100.0 /100.0 |
9 /9 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | NS1_INBLE Non-structural protein 1[97 aa] | D | 100.0 /100.0 |
10 /10 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | NS1_INBLE Non-structural protein 1[92 aa] | A | 80.0 /65.3 |
10 /10 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | NS1_INBLE Non-structural protein 1[94 aa] | C | 75.0 /70.4 |
12 /12 |
E2R7R1_CANLF ISG15 ubiquitin-like modifier |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | NS1_INBLE Non-structural protein 1[94 aa] | D | 76.9 /70.4 |
13 /13 |
E2R7R1_CANLF ISG15 ubiquitin-like modifier |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | NS1_INBLE Non-structural protein 1[92 aa] | C | 50.0 /65.1 |
14 /14 |
ISG15_BOVIN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | NS1_INBLE Non-structural protein 1[91 aa] | C | 45.5 /65.1 |
11 /11 |
ISG15_BOVIN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | NS1_INBLE Non-structural protein 1[92 aa] | D | 60.0 /65.1 |
10 /10 |
ISG15_BOVIN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | NS1_INBLE Non-structural protein 1[91 aa] | D | 60.0 /65.1 |
10 /10 |
ISG15_BOVIN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | A0A191KWA2_9VIRU RNA-dependent RNA polymerase[158 aa] | B | 86.7 /64.5 |
15 /15 |
Q9GKP4_SHEEP Interferon stimulated gene 17 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | A0A191KWA2_9VIRU RNA-dependent RNA polymerase[158 aa] | D | 86.7 /64.7 |
15 /15 |
Q9GKP4_SHEEP Interferon stimulated gene 17 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | J3RTH4_9VIRU RNA-dependent RNA polymerase[159 aa] | A | 61.1 /64.5 |
18 /18 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | J3RTH4_9VIRU RNA-dependent RNA polymerase[158 aa] | C | 61.1 /64.5 |
18 /18 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_CVHSA Replicase polyprotein 1ab[312 aa] | C | 100.0 /100.0 |
12 /13 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_CVHSA Replicase polyprotein 1ab[315 aa] | D | 100.0 /100.0 |
9 /10 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_CVHSA Replicase polyprotein 1ab[316 aa] | A | 68.8 /64.5 |
16 /17 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | R1AB_CVHSA Replicase polyprotein 1ab[313 aa] | C | 76.9 /64.5 |
13 /14 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
165 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() |
![]() |
D |
AMP
|
B | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() |
![]() |
E |
AMP
|
B | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() |
![]() |
E |
AMP
|
B | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() |
![]() |
D |
AMP
|
B | 100.0 /98.8 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() |
![]() |
E |
AMP
|
B | 100.0 /100.0 |
2 /2 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C |
SIN
|
A | 100.0 /99.3 |
2 /2 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C |
SIN
|
A | 100.0 /99.3 |
2 /2 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D |
SIN
|
A | 100.0 /99.3 |
7 /7 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D |
SIN
|
A | 100.0 /99.3 |
7 /7 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
165 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() |
![]() |
H |
ZN
|
B | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() |
![]() |
N |
ZN
|
B | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() |
![]() |
N |
ZN
|
B | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
O |
ZN
|
B | 100.0 /100.0 |
2 /2 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
O |
ZN
|
B | 100.0 /100.0 |
2 /2 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() |
![]() |
P |
ZN
|
B | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() |
![]() |
P |
ZN
|
B | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B |
OS4
|
A | 100.0 /99.3 |
3 /3 |
UCRP_HUMAN interferon, alpha-inducible protein (clone IFI-15K.. |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
165 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() |
![]() |
M |
NEH
|
B | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() |
![]() |
M |
NEH
|
B | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() |
![]() |
Q |
ACY
|
B | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() |
![]() |
Q |
ACY
|
B | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D |
GOL
|
B | 100.0 /98.7 |
7 /7 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F |
GOL
|
A | 66.7 /64.4 |
6 /6 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G |
GOL
|
A | 75.0 /64.4 |
4 /4 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H |
GOL
|
A | 100.0 /64.4 |
2 /2 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J |
GOL
|
D | 50.0 /65.1 |
4 /4 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
L |
GOL
|
A | 100.0 /65.6 |
2 /2 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
M |
GOL
|
A | 100.0 /65.6 |
4 /4 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
O |
GOL
|
B | 25.0 /64.9 |
4 /4 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
P |
GOL
|
B | 50.0 /64.9 |
2 /2 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
Q |
GOL
|
B | 100.0 /64.9 |
1 /1 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
W |
GOL
|
D | 60.0 /65.6 |
5 /5 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
CA |
GOL
|
G | 100.0 /65.6 |
2 /2 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
DA |
GOL
|
G | 80.0 /65.6 |
5 /5 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
FA |
GOL
|
I | 75.0 /64.4 |
4 /4 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() |
![]() |
G |
GOL
|
C | 100.0 /99.3 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() |
![]() |
H |
GOL
|
C | 100.0 /99.3 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() |
![]() |
N |
GOL
|
D | 100.0 /99.3 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
O |
GOL
|
D | 100.0 /99.3 |
2 /2 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J |
GOL
|
B | 100.0 /100.0 |
5 /5 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
K |
MPD
|
A | 100.0 /100.0 |
2 /2 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
N |
MPD
|
C | 100.0 /100.0 |
2 /2 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
O |
MPD
|
C | 100.0 /100.0 |
4 /4 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J |
MPD
|
B | 100.0 /100.0 |
2 /2 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
T |
MPD
|
D | 100.0 /100.0 |
3 /3 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
T |
PGE
|
C | 100.0 /99.3 |
4 /4 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J |
PGE
|
D | 100.0 /99.3 |
4 /4 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() |
![]() |
C |
4LJ
|
B | 100.0 /98.7 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() |
![]() |
E |
AYE
|
A | 100.0 /64.5 |
1 /1 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() |
![]() |
H |
AYE
|
C | 100.0 /64.5 |
1 /1 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() |
![]() |
E |
AYE
|
A | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() |
![]() |
M |
AYE
|
C | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() |
![]() |
H |
AYE
|
B | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() |
![]() |
P |
AYE
|
D | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() |
![]() |
I |
AYE
|
C | 100.0 /99.3 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() |
![]() |
S |
AYE
|
D | 100.0 /99.3 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() |
![]() |
I |
AYE
|
B | 100.0 /73.3 |
1 /1 |
Q9GKP4_SHEEP Interferon stimulated gene 17 |
![]() ![]() ![]() ![]() |
![]() |
J |
AYE
|
D | 100.0 /73.3 |
1 /1 |
Q9GKP4_SHEEP Interferon stimulated gene 17 |
![]() ![]() ![]() ![]() |
![]() |
K |
AYE
|
F | 100.0 /73.3 |
1 /1 |
Q9GKP4_SHEEP Interferon stimulated gene 17 |
![]() ![]() ![]() ![]() |
![]() |
L |
AYE
|
H | 100.0 /73.3 |
1 /1 |
Q9GKP4_SHEEP Interferon stimulated gene 17 |
![]() ![]() ![]() ![]() |
![]() |
E |
AYE
|
B | 100.0 /64.5 |
1 /1 |
Q9GKP4_SHEEP Interferon stimulated gene 17 |
![]() ![]() ![]() ![]() |
![]() |
F |
AYE
|
D | 100.0 /64.7 |
1 /1 |
Q9GKP4_SHEEP Interferon stimulated gene 17 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I |
SO4
|
A | 66.7 /64.4 |
3 /3 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
K |
SO4
|
D | 0.0 /65.1 |
1 /1 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
L |
SO4
|
D | 0.0 /65.1 |
2 /2 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
K |
SO4
|
A | 60.0 /65.6 |
5 /5 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
N |
SO4
|
B | 60.0 /64.9 |
5 /5 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
R |
SO4
|
C | 75.0 /64.7 |
4 /4 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
S |
SO4
|
D | 66.7 /65.6 |
3 /3 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
T |
SO4
|
D | 33.3 /65.6 |
3 /3 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
U |
SO4
|
D | 33.3 /65.6 |
3 /3 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
V |
SO4
|
D | 60.0 /65.6 |
5 /5 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
X |
SO4
|
E | 50.0 /65.6 |
2 /2 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
Y |
SO4
|
E | 100.0 /65.6 |
1 /1 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
Z |
SO4
|
E | 75.0 /65.6 |
4 /4 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
AA |
SO4
|
G | 33.3 /65.6 |
3 /3 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
BA |
SO4
|
G | 50.0 /65.6 |
4 /4 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
EA |
SO4
|
H | 60.0 /64.7 |
5 /5 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F |
FLC
|
A | 25.0 /64.5 |
4 /4 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I |
FLC
|
C | 40.0 /64.5 |
5 /5 |
ISG15_MOUSE Ubiquitin-like protein ISG15 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |