Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
1484564 | 97 | 12 | P0DTD2(ORF9B_SARS2) | RecName: Full=ORF9b protein; Short=ORF9b;AltName: Full=Accessory protein 9b;AltName: Full=ORF-9b;AltName: Full=Protein 9b; |
QUERYSEQ |
MDPKISEMHPALRLVDPQIQLAVTRMENAVGRDQNNVGPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK |
97 | region | name | description |
1-97 | CHAIN | /note="ORF9b protein" /id="PRO_0000449657" | |
8-97 | DOMAIN | /note="9b" | |
1-4 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
97 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
7ye8 | B | 100.0 | ORF9B_SARS2 ORF9b protein | ||||
6z4u | A | 100.0 | ORF9B_SARS2 Protein 9b | ||||
6z4u | B | 100.0 | ORF9B_SARS2 Protein 9b | ||||
7ye8 | A | 100.0 | ORF9B_SARS2 ORF9b protein | ||||
7ye7 | B | 100.0 | ORF9B_SARS2 ORF9b protein | ||||
7ye8 | D | 100.0 | ORF9B_SARS2 ORF9b protein | ||||
7ye8 | C | 100.0 | ORF9B_SARS2 ORF9b protein | ||||
7ye7 | D | 100.0 | ORF9B_SARS2 ORF9b protein | ||||
7ye7 | A | 100.0 | ORF9B_SARS2 ORF9b protein | ||||
7ye7 | C | 100.0 | ORF9B_SARS2 ORF9b protein | ||||
7kdt | B | 100.0 | ORF9B_SARS2 ORF9b protein | ||||
7dhg | B | 100.0 | ORF9B_SARS2 ORF9b protein | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
97 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7dhg | A | TOM70_HUMAN Mitochondrial import receptor subunit TOM70[470 aa.. | B | 100.0 /100.0 |
29 /29 |
ORF9B_SARS2 ORF9b protein | |
7kdt | A | TOM70_HUMAN Mitochondrial import receptor subunit TOM70[467 aa.. | B | 100.0 /100.0 |
28 /28 |
ORF9B_SARS2 ORF9b protein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND | |||||||
97 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
6z4u | C |
15P
POLYETHYLENE GLYCOL (N=34)[14 atoms] |
B | 100.0 /100.0 |
7 /7 |
ORF9B_SARS2 Protein 9b | |
7ye7 | E |
DD9
nonane[9 atoms] |
A | 100.0 /100.0 |
1 /1 |
ORF9B_SARS2 ORF9b protein | |
7ye7 | E |
DD9
nonane[9 atoms] |
B | 100.0 /100.0 |
2 /2 |
ORF9B_SARS2 ORF9b protein | |
7ye7 | F |
OCT
N-OCTANE[8 atoms] |
C | 100.0 /100.0 |
3 /3 |
ORF9B_SARS2 ORF9b protein | |
7ye7 | F |
OCT
N-OCTANE[8 atoms] |
D | 100.0 /100.0 |
1 /1 |
ORF9B_SARS2 ORF9b protein | |
7ye8 | E |
OCT
N-OCTANE[8 atoms] |
A | 100.0 /100.0 |
2 /2 |
ORF9B_SARS2 ORF9b protein | |
7ye8 | E |
OCT
N-OCTANE[8 atoms] |
B | 100.0 /100.0 |
2 /2 |
ORF9B_SARS2 ORF9b protein | |
7ye8 | F |
OCT
N-OCTANE[8 atoms] |
C | 100.0 /100.0 |
2 /2 |
ORF9B_SARS2 ORF9b protein | |
7ye8 | F |
OCT
N-OCTANE[8 atoms] |
D | 100.0 /100.0 |
1 /1 |
ORF9B_SARS2 ORF9b protein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
97 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
6z4u | B | ORF9B_SARS2 Protein 9b[82 aa] | A | 100.0 /100.0 |
33 /33 |
ORF9B_SARS2 Protein 9b | |
6z4u | A | ORF9B_SARS2 Protein 9b[84 aa] | B | 100.0 /100.0 |
34 /34 |
ORF9B_SARS2 Protein 9b | |
7ye7 | A | ORF9B_SARS2 ORF9b protein[74 aa] | B | 100.0 /100.0 |
31 /31 |
ORF9B_SARS2 ORF9b protein | |
7ye7 | D | ORF9B_SARS2 ORF9b protein[74 aa] | C | 100.0 /100.0 |
33 /33 |
ORF9B_SARS2 ORF9b protein | |
7ye7 | C | ORF9B_SARS2 ORF9b protein[72 aa] | D | 100.0 /100.0 |
31 /31 |
ORF9B_SARS2 ORF9b protein | |
7ye8 | A | ORF9B_SARS2 ORF9b protein[79 aa] | B | 100.0 /100.0 |
39 /39 |
ORF9B_SARS2 ORF9b protein | |
7ye8 | D | ORF9B_SARS2 ORF9b protein[78 aa] | C | 100.0 /100.0 |
34 /34 |
ORF9B_SARS2 ORF9b protein | |
7ye8 | C | ORF9B_SARS2 ORF9b protein[75 aa] | D | 100.0 /100.0 |
34 /34 |
ORF9B_SARS2 ORF9b protein | |
7ye7 | B | ORF9B_SARS2 ORF9b protein[78 aa] | A | 100.0 /100.0 |
32 /32 |
ORF9B_SARS2 ORF9b protein | |
7ye8 | B | ORF9B_SARS2 ORF9b protein[88 aa] | A | 100.0 /100.0 |
34 /34 |
ORF9B_SARS2 ORF9b protein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |