Contact Molecules for Homologous Proteins | ||||
![]() [Full Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
11199 | 492 | 31 | O15393(TMPS2_HUMAN) | RecName: Full=Transmembrane protease serine 2 ; EC=3.4.21.122 ;AltName: Full=Serine protease 10 ;Contains: RecName: Full=Transmembrane protease serine 2 non-catalytic chain;Contains: RecName: Full=Transmembrane protease serine 2 catalytic chain;Flags: Precursor; |
QUERYSEQ |
MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVR LYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEK PLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKN NIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG |
492 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
region | name | description |
![]() ![]() |
1-255 | CHAIN | /note="Transmembrane protease serine 2 non-catalytic chain" /id="PRO_0000027855" |
![]() ![]() |
256-492 | CHAIN | /note="Transmembrane protease serine 2 catalytic chain" /id="PRO_0000027856" |
![]() ![]() |
1-84 | TOPO_DOM | /note="Cytoplasmic" |
![]() ![]() ![]() |
85-105 | TRANSMEM | /note="Helical; Signal-anchor for type II membrane protein" |
![]() ![]() |
106-492 | TOPO_DOM | /note="Extracellular" |
![]() ![]() ![]() |
112-149 | DOMAIN | /note="LDL-receptor class A" |
![]() ![]() ![]() |
150-242 | DOMAIN | /note="SRCR" |
![]() ![]() ![]() |
256-489 | DOMAIN | /note="Peptidase S1" |
![]() ![]() ![]() |
296-296 | ACT_SITE | /note="Charge relay system" |
![]() ![]() ![]() |
345-345 | ACT_SITE | /note="Charge relay system" |
![]() ![]() ![]() |
441-441 | ACT_SITE | /note="Charge relay system" |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
1-492 | DISORDER | predicted by DISOPRED |
![]() |
|||||||
492 | |||||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
pdb_id | a1 | identity[%]2 | description | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 99.4 | TMPS2_HUMAN Transmembrane protease serine 2 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
![]() |
|||||||
492 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain[24.. | A | 100.0 /100.0 |
25 /25 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | TMPS2_HUMAN Transmembrane protease serine 2[238 aa] | A | 100.0 /100.0 |
21 /21 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain[12.. | B | 100.0 /100.0 |
26 /28 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain[12.. | D | 100.0 /100.0 |
29 /29 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain[13.. | D | 100.0 /100.0 |
29 /29 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | M9ZTT7_PAESO Hemorrhagic toxin[2615 aa] | B | 100.0 /100.0 |
17 /17 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | MALE_ECOLI M9ZTT7_PAESO Maltose/maltodextrin-binding periplasmic protein,H.. | A | 100.0 /100.0 |
17 /17 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | B | 100.0 /100.0 |
24 /24 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | SPIKE_CVHN2 Spike glycoprotein[1208 aa] | D | 100.0 /99.7 |
13 /13 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | SPIKE_CVHN1 Spike protein S1[280 aa] | B | 100.0 /99.4 |
15 /15 |
TMPS2_HUMAN Transmembrane protease serine 2 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
492 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C |
GBS
|
A | 100.0 /100.0 |
14 /14 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G |
GBS
|
B | 100.0 /100.0 |
12 /12 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E |
NAG
|
A | 100.0 /100.0 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G |
I9V
|
B | 100.0 /100.0 |
18 /18 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G |
TAM
|
A | 100.0 /100.0 |
6 /6 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
N |
TAM
|
B | 100.0 /100.0 |
6 /6 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
P |
TAM
|
B | 100.0 /100.0 |
5 /5 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
O |
7R8
|
B | 100.0 /100.0 |
10 /10 |
TMPS2_HUMAN Transmembrane protease serine 2 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
492 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D |
UNX
|
A | 100.0 /100.0 |
2 /2 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E |
UNX
|
A | 100.0 /100.0 |
1 /1 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() |
![]() |
E |
UNX
|
A | 100.0 /100.0 |
1 /1 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H |
UNX
|
A | 100.0 /100.0 |
2 /2 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. |
![]() ![]() ![]() ![]() |
![]() |
H |
UNX
|
B | 100.0 /100.0 |
1 /1 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
Z |
UNX
|
C | 100.0 /100.0 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F |
CA
|
A | 100.0 /100.0 |
6 /6 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain |
![]() ![]() ![]() ![]() |
![]() |
J |
CA
|
B | 100.0 /100.0 |
1 /1 |
TMPS2_HUMAN Transmembrane protease serine 2 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
492 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
6 /6 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. | C | 100.0 /100.0 |
6 /6 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | B | 100.0 /99.4 |
2 /2 |
TMPS2_HUMAN Transmembrane protease serine 2 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
492 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | TMPS2_HUMAN Transmembrane protease serine 2[345 aa] | D | 100.0 /99.7 |
2 /2 |
TMPS2_HUMAN Transmembrane protease serine 2 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
492 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
K |
GOL
|
D | 100.0 /100.0 |
12 /12 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain |
![]() ![]() ![]() ![]() ![]() |
![]() |
D |
EDO
|
A | 100.0 /100.0 |
1 /1 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. |
![]() ![]() ![]() ![]() ![]() |
![]() |
F |
EDO
|
A | 100.0 /100.0 |
1 /1 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. |
![]() ![]() ![]() ![]() ![]() |
![]() |
L |
EDO
|
A | 100.0 /100.0 |
2 /2 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
K |
EDO
|
B | 100.0 /100.0 |
4 /4 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
L |
EDO
|
B | 100.0 /100.0 |
4 /4 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() |
![]() |
O |
EDO
|
B | 100.0 /100.0 |
1 /1 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() |
![]() |
P |
EDO
|
B | 100.0 /100.0 |
2 /2 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() ![]() |
![]() |
I |
EDO
|
A | 100.0 /100.0 |
1 /1 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
M |
EDO
|
A | 100.0 /100.0 |
4 /4 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. |
![]() ![]() ![]() ![]() ![]() |
![]() |
T |
EDO
|
A | 100.0 /100.0 |
1 /1 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
L |
EDO
|
B | 100.0 /100.0 |
2 /2 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
M |
EDO
|
B | 100.0 /100.0 |
5 /5 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() |
![]() |
Q |
EDO
|
B | 100.0 /100.0 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
R |
EDO
|
B | 100.0 /100.0 |
7 /7 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
S |
EDO
|
B | 100.0 /100.0 |
5 /5 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
T |
EDO
|
B | 100.0 /100.0 |
2 /2 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
V |
EDO
|
B | 100.0 /100.0 |
5 /5 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
AA |
EDO
|
C | 100.0 /100.0 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
IA |
EDO
|
D | 100.0 /100.0 |
5 /5 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
MA |
EDO
|
D | 100.0 /100.0 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() |
![]() |
I |
CIT
|
B | 100.0 /100.0 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
CA |
CIT
|
C | 100.0 /100.0 |
2 /2 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
Y |
CIT
|
C | 100.0 /100.0 |
3 /4 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
CA |
CIT
|
D | 100.0 /100.0 |
4 /4 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
N |
PG4
|
B | 100.0 /100.0 |
7 /7 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
BA |
PG4
|
C | 100.0 /100.0 |
6 /6 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
BA |
PG4
|
D | 100.0 /100.0 |
2 /2 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
JA |
PG4
|
D | 100.0 /100.0 |
11 /11 |
TMPS2_HUMAN Transmembrane protease serine 2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
X |
PEG
|
C | 100.0 /100.0 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |