Contact Molecules for Homologous Proteins | ||||
![]() [Summary Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
10624 | 97 | 12 | P0DTD2(ORF9B_SARS2) | RecName: Full=ORF9b protein; Short=ORF9b;AltName: Full=Accessory protein 9b;AltName: Full=ORF-9b;AltName: Full=Protein 9b; |
QUERYSEQ |
MDPKISEMHPALRLVDPQIQLAVTRMENAVGRDQNNVGPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK |
97 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
region | name | description |
![]() |
1-97 | CHAIN | /note="ORF9b protein" /id="PRO_0000449657" |
![]() ![]() |
8-97 | DOMAIN | /note="9b" |
![]() ![]() |
1-4 | DISORDER | predicted by DISOPRED |
![]() |
|||||||
97 | |||||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
pdb_id | a1 | identity[%]2 | description | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | ORF9B_SARS2 ORF9b protein | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 100.0 | ORF9B_SARS2 Protein 9b | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | ORF9B_SARS2 Protein 9b | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 100.0 | ORF9B_SARS2 ORF9b protein | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | ORF9B_SARS2 ORF9b protein | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | ORF9B_SARS2 ORF9b protein | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 100.0 | ORF9B_SARS2 ORF9b protein | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | ORF9B_SARS2 ORF9b protein | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 100.0 | ORF9B_SARS2 ORF9b protein | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 100.0 | ORF9B_SARS2 ORF9b protein | |||
![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | ORF9B_SARS2 ORF9b protein | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | ORF9B_SARS2 ORF9b protein | |||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
![]() |
|||||||
97 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | TOM70_HUMAN Mitochondrial import receptor subunit TOM70[470 aa.. | B | 100.0 /100.0 |
29 /29 |
ORF9B_SARS2 ORF9b protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | TOM70_HUMAN Mitochondrial import receptor subunit TOM70[467 aa.. | B | 100.0 /100.0 |
28 /28 |
ORF9B_SARS2 ORF9b protein |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
97 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C |
15P
|
B | 100.0 /100.0 |
7 /7 |
ORF9B_SARS2 Protein 9b |
![]() ![]() ![]() ![]() |
![]() |
E |
DD9
|
A | 100.0 /100.0 |
1 /1 |
ORF9B_SARS2 ORF9b protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E |
DD9
|
B | 100.0 /100.0 |
2 /2 |
ORF9B_SARS2 ORF9b protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F |
OCT
|
C | 100.0 /100.0 |
3 /3 |
ORF9B_SARS2 ORF9b protein |
![]() ![]() ![]() ![]() ![]() |
![]() |
F |
OCT
|
D | 100.0 /100.0 |
1 /1 |
ORF9B_SARS2 ORF9b protein |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E |
OCT
|
A | 100.0 /100.0 |
2 /2 |
ORF9B_SARS2 ORF9b protein |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E |
OCT
|
B | 100.0 /100.0 |
2 /2 |
ORF9B_SARS2 ORF9b protein |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F |
OCT
|
C | 100.0 /100.0 |
2 /2 |
ORF9B_SARS2 ORF9b protein |
![]() ![]() ![]() ![]() ![]() |
![]() |
F |
OCT
|
D | 100.0 /100.0 |
1 /1 |
ORF9B_SARS2 ORF9b protein |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
97 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | ORF9B_SARS2 Protein 9b[82 aa] | A | 100.0 /100.0 |
33 /33 |
ORF9B_SARS2 Protein 9b |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | ORF9B_SARS2 Protein 9b[84 aa] | B | 100.0 /100.0 |
34 /34 |
ORF9B_SARS2 Protein 9b |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | ORF9B_SARS2 ORF9b protein[74 aa] | B | 100.0 /100.0 |
31 /31 |
ORF9B_SARS2 ORF9b protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | ORF9B_SARS2 ORF9b protein[74 aa] | C | 100.0 /100.0 |
33 /33 |
ORF9B_SARS2 ORF9b protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | ORF9B_SARS2 ORF9b protein[72 aa] | D | 100.0 /100.0 |
31 /31 |
ORF9B_SARS2 ORF9b protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | ORF9B_SARS2 ORF9b protein[79 aa] | B | 100.0 /100.0 |
39 /39 |
ORF9B_SARS2 ORF9b protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | ORF9B_SARS2 ORF9b protein[78 aa] | C | 100.0 /100.0 |
34 /34 |
ORF9B_SARS2 ORF9b protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | ORF9B_SARS2 ORF9b protein[75 aa] | D | 100.0 /100.0 |
34 /34 |
ORF9B_SARS2 ORF9b protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | ORF9B_SARS2 ORF9b protein[78 aa] | A | 100.0 /100.0 |
32 /32 |
ORF9B_SARS2 ORF9b protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | ORF9B_SARS2 ORF9b protein[88 aa] | A | 100.0 /100.0 |
34 /34 |
ORF9B_SARS2 ORF9b protein |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |