#WARNING:no index is registered index 'b'YP_009725309.1'' in 'http://www.uniprot.org/uniprot/' Protein Model on 5nfy_B_1_P_1

Protein Model on 5nfy_B_1_P_1 (TEMPLATE: 5nfy )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [514 aa] Polyprotein 1ab :Q1T6X8_CVHSA
2 b P 1 (B) non-polymer(ZN) ZINC ION 452C 475T 477C 484C 487H (identity: 100.0 %/92.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5nfy_B_1 identity=92.8%
queryA         1:AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREA: 100
                :************* **************** ******************************************************************* *:
5nfy_B_1       8:AENVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDA: 107
SecStr          :      TT B B   S   TTT SSTTTS GGGEETTEE   TTS   S  EEEE           TTS  SB  HHHHHHT SSEEEEEEEEEEE SSB:    
ExpBur          :eeeeeeeeeebbeeeebbbeebbeeeeebbeebeeeeeeeeeeeeeeeeebebbbbbeebeeeeeeeeebebebeeeebeebbbbbbbbbbbbbebbeeb:    

queryA       101:VGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVK: 200
                :*************************** *** * ** ************************************** ************************:
5nfy_B_1     108:VGTNLPLQLGFSTGVNLVAVPTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDRVVFVLWAHGFELTSMKYFVK: 207
SecStr          : S EEEEEEEESSS EEE   EEEEEESSSEEEEE  EE  SSGGGGGGSGGGTS   HHHHHHHHHHHHHHHHTTT SS EEEESSHHHHHHHHTTTEE:    
ExpBur          :eebebbbbbbbbeeeebbbbbbbbbbbeeeeeeeebeeeebeeeeeeebeebbeeeeebeebbeebbebbbeebeebbebbbbbbbeeebbbbbbebbbe:    

queryA       201:IGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG: 300
                :*********** ******* ******* ** ***************************  ********************************  ******:
5nfy_B_1     208:IGPERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPFMIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIG: 307
SecStr          :  S  B SSSSSB  EEETTTTEEE SSS TT  EEES EEEEGGGGT  S HHHHHHTS SSS   SSHHHHHHHHHHHHHHTTSSSS  TT      S:    
ExpBur          :ebeeeebeeeeebbbbbbeeeeebbbbeebeebbbbbbbbbbbbeebebeeebeebbeeebeeeeeeeebbbebebbbbbbbbebbeeeeeeebebeeee:    

queryA       301:DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCR: 400
                :***  * *********** ************************* ************************** * ********************* ****:
5nfy_B_1     308:DELRVNSACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQAEVEWKFYDAQPCSDKAYKIEELFYSYAIHHDKFTDGVCLFWNCNVDRYPANAIVCR: 407
SecStr          :S HHHHHHHHHHHHHHHHHHHHHH  SEEEEES SS   SSSS  SEEEEEESS  STTSTTEEE    HHHHTTS  SSEEEEES   S   SSEEEEE:    
ExpBur          :ebeebeebbeebbebbbebbbebeebebbbbbebeebeebbeebebebebbbeeeeeeeeeebeeeebbbeebeeebeebbbbbbebebeebbebbbbbb:    

queryA       401:FDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNM: 500
                :************************************ ****************           **************************** *******:
5nfy_B_1     408:FDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCEXXXXXXXXXXXYVPLKSATCITRCNLGGAVCRHHANEYRQYLDAYNM: 507
SecStr          :E TT  STTEEE SSS EEE SSS EEE    GGGGTTEEE    EEE S   -----------      TTEEETTTTTT   HHHHHHHHHHHHHHHH:    
ExpBur          :bbbeeeeebbbebbeebbbbbbebbeebeebeeebbebbeebebbbbbeeeee-----------eeeeeeeebbbebbeeeeebeebeeebeebeebbeb:    
Contact         :                                                   b                      b b      b  b             


Input Residue Numbers for Focused Sites

ex) 2,15,123