#WARNING:no index is registered index 'b'YP_009725309.1'' in 'http://www.uniprot.org/uniprot/' Protein Model on 5c8u_D_1_C_1

Protein Model on 5c8u_D_1_C_1 (TEMPLATE: 5c8u )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) D 1 (D) polymer(polypeptide(L)) [514 aa] Guanine-N7 methyltransferase :R1AB_CVHSA
2 b C 1 (C) polymer(polypeptide(L)) [133 aa] Non-structural protein 10 :R1AB_CVHSA 3N 4V 5T 8F 9K 10D 20P 21T 22Q 23A 24P 25T 26H 27L 29V 38L 39C 40V 41D 47K 51Y 55I 60F 61K 62M 63N 64Y 66V 69Y 101V 102G 126D 127T 128P(E) 129N 130N 131T 192L 195M 196K 200K 201I 217F 224Y 237Y (identity: 97.8 %/93.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5c8u_D_1 identity=93.0%
queryA         1:AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREA: 100
                :************* **************** ******************************************************************* *:
5c8u_D_1       2:AENVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDA: 101
SecStr          :     SSS B B  SS   SSS SSTTTS GGGEETTEE   TTS   SS  EEE           TT   SB  HHHHHHTGGGEEEEEEEEEEE SSB:    
ExpBur          :eeeeeebeeebbeeeebbbeeebeeeeebbeebeeeeeeeeeeeeeeeeebebbbbbeeeeeeeeeeeebebebeeeebbebbbbbbbbbbebbebeeeb:    
Contact         :  bbb  bbb         bbbbbbbb b        bbbb     b   b   b    bbbbb b  b                               

queryA       101:VGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVK: 200
                :*************************** *** * ** ************************************** ************************:
5c8u_D_1     102:VGTNLPLQLGFSTGVNLVAVPTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDRVVFVLWAHGFELTSMKYFVK: 201
SecStr          : S EEEEEEEESSS EEEB  EEEEE SS EEEEE  EE  SSGGGGGGHHHHTS B HHHHHHHHHHHHHHHHHTT SS EEEESSHHHHHHHHHHHB :    
ExpBur          :eebbbbbbbbbbeeeebbbbbbbbbbbeeeeeeeebebeebebeeeeebeebbeeeeebeebbeebbebbbeebeeebebbbbbbbeeebbbbbbebbbe:    
Contact         :bb                       bbbbbb                                                            b  bb   b

queryA       201:IGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG: 300
                :*********** ******* ******* ** ***************************  ********************************  ******:
5c8u_D_1     202:IGPERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPFMIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIG: 301
SecStr          :  S  B SSSSSB  EEETTTTEEE TTT SS  EE S EEEEGGGS  SS HHHHHHHH SSS   SSHHHHHHHHHHHHHHHHSTTT  SS     SS:    
ExpBur          :ebeeeebeeeeebbbbbbeeeeebbbbeebeebbbbbbbbbbbbeeeeeeeebeebbeeebeeeeeeeebbbbbebbbbbbbbebbeeeeeeebebeeee:    
Contact         :b               b      b            b                                                               

queryA       301:DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCR: 400
                :***  * *********** ************************* **************************** ********************* ****:
5c8u_D_1     302:DELRVNSACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQAEVEWKFYDAQPCSDKAYKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPANAIVCR: 401
SecStr          : HHHHHHHHHHHHHHHHHHHHHHS  SEEEEET  SS  S SS  SEEEEE SS  SSSS         HHHHTTT  SSEEEEES   SS  TTEEEEE:    
ExpBur          :ebeebeebbeebeebbbebbbebeebebbbbbebbeeeeebeebebebeebbeeeeeeebeeeeebebeeeebeeebeebbbbbbebebeebbebbbbbb:    

queryA       401:FDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNM: 500
                :************************************ ****************           **************************** *******:
5c8u_D_1     402:FDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCEXXXXXXXXXXXYVPLKSATCITRCNLGGAVCRHHANEYRQYLDAYNM: 501
SecStr          :E TTS  TTEEE SSS EEE SSS  EE    TTTSTTSEE    EEE S   -----------      TTEEETT SSS   HHHHHHHHHHHHHHHH:    
ExpBur          :bbbeeeeebbbebbeebbbbbbebbebbeeeeeebbebbeebeebbbbebeee-----------eeebebeebbbeebeeeebbeebbeebeebeebbee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123