#WARNING:no index is registered index 'b'YP_009725309.1'' in 'http://www.uniprot.org/uniprot/' Protein Model on 5c8t_D_1_R_1

Protein Model on 5c8t_D_1_R_1 (TEMPLATE: 5c8t )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) D 1 (D) polymer(polypeptide(L)) [514 aa] Guanine-N7 methyltransferase :R1AB_CVHSA
2 b R 1 (D) non-polymer(SAM) S-ADENOSYLMETHIONINE 292W 333G 334N 335P 352D 353A 354Q 366L 367F 368Y 385W 386N 387C 388N 426F (identity: 100.0 %/93.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5c8t_D_1 identity=93.0%
queryA         1:AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREA: 100
                :************* **************** ******************************************************************* *:
5c8t_D_1       2:AENVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDA: 101
SecStr          :     SSS B B  S    STT SSGGGS GGGEETTEE   TTS   SS  EEE           TT   SB  HHHHHHTGGGEEEEEEEEEEE SSB:    
ExpBur          :eeeeeebeeebbeeeebbbeeebeeeeebbeebeeeeeeeeeeeeeeeeebebbbbbeeeeeeeeeeeebebebeeeebbebbbbbbbbbbebbebeeeb:    

queryA       101:VGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVK: 200
                :*************************** *** * ** ************************************** ************************:
5c8t_D_1     102:VGTNLPLQLGFSTGVNLVAVPTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDRVVFVLWAHGFELTSMKYFVK: 201
SecStr          : S EEEEEEEESSS EEEB  EEEEE SS EEEEE  EE  SSGGGGGGHHHHHS B HHHHHHHHHHHHHHHHTTT SS EEEES HHHHHHHHHHHB :    
ExpBur          :eebebbbbbbbeeeeebbbbbbbbbbbeeeeeeeebeeeebebeeeeebeebbeeeeebeebbeebbebbbeebeebbebbbbbbbeeebbbbbbebbbe:    

queryA       201:IGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG: 300
                :*********** ******* ******* ** ***************************  ********************************  ******:
5c8t_D_1     202:IGPERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPFMIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIG: 301
SecStr          :  S  B SSSSSB  EEETTTTEEE SSS SS  EESS EEEETTSS  SS HHHHHHHH  SS   SSHHHHHHHHHHHHHHHHHTSS  TT     SS:    
ExpBur          :ebeeeebeeeeebbbbbbeeeeebbbbeebeebbbbbbbbbbbbeeeeeeeebeebbeeebeebeeeeebbbbbebbbbbbbeebbeeebeeebebeeee:    
Contact         :                                                                                           b        

queryA       301:DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCR: 400
                :***  * *********** ************************* **************************** ********************* ****:
5c8t_D_1     302:DELRVNSACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQAEVEWKFYDAQPCSDKAYKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPANAIVCR: 401
SecStr          :  HHHHHHHHHHHHHHHHHHHHHH  SEEEEET  SS  S TT  SEEEEE SS  STT TTSB     HHHHTTT  SSEEEEES   SS  TTEEEEE:    
ExpBur          :ebeebeebbeebbebbbebbbebeebebbbbbebbebeebbeeeebebebbbbebeeeeeeebeebebeeeebeeebeebbbbbbebebeebbebbbbbb:    
Contact         :                                bbb                bbb           bbb                bbbb            

queryA       401:FDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNM: 500
                :************************************ ****************           **************************** *******:
5c8t_D_1     402:FDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCEXXXXXXXXXXXYVPLKSATCITRCNLGGAVCRHHANEYRQYLDAYNM: 501
SecStr          :E TT   TTEEE SSS EEE SSS EEE    GGGGTTSEE    EE  S   -----------      TTEE TT  SS   HHHHHHHHHHHHHHHH:    
ExpBur          :bbbeeeeebbbebbeebbbbbbebbebbeeeeeebbebbeebeebbbbeeeee-----------eeebebeebbbeebeeeebbeebbeebeebeebbee:    
Contact         :                         b                                                                          


Input Residue Numbers for Focused Sites

ex) 2,15,123