#WARNING:no index is registered index "YP_009724389.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009724389.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein. [pdbjlvh2]Protein Model on 8cx9_B_1_R_1

Protein Model on 8cx9_B_1_R_1 (TEMPLATE: 8cx9 )

CurrentView:HTML5 Change to:[JAVA] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (A) polymer(polypeptide(L)) [314 aa] Papain-like protease nsp3 :R1A_SARS2
2 b R 1 (A) non-polymer(NA) SODIUM ION 1727D 1827Y (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:8cx9_B_1 identity=100.0%
queryA      1565:VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGL:1664
                :****************************************************************************************************:
8cx9_B_1       7:VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGL: 106
SecStr          :  EEEEEEESSSSS EEEEEESSS HHHHTSSEEETTEE TT    GGGTT EEEE   SHHHHHHHHHHH    TTSHHHHHHHHHHHTTS   EETTE:    
ExpBur          :eeebebebbbbeeeeeeeebeeeebbeeebeebbeebeebeeebbeeebeeeebbbebeeeebeebbeebbeeeeeebbeebbebbeebeebbbeebeeb:    

queryA      1665:TSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKG:1764
                :****************************************************************************************************:
8cx9_B_1     107:TSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKG: 206
SecStr          :E     TTTHHHHHHHHHHTTS   BSSHHHHHHHHHHTTT  HHHHHHHHHHTT  TT    HHHHHHHHHTTB  SS EEEEEEEETTTEEEEEEEES:    
ExpBur          :bbbeeeeebbbbbbbbbbbbebebebebebbeebbeebeeeebbebbbbbbbbbebebeeebebeebbeebbeebebeebebbbbbebeeeeeeeeeeeb:    
Contact         :                                                              b                                     

queryA      1765:VEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT:1864
                :****************************************************************************************************:
8cx9_B_1     207:VEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT: 306
SecStr          :GGGSEEES S HHHHHH EEEE SSSSEEEEEEEEEE SEEEEEEEEEEEEE TTS SEEEEE SBTTB  EEEEEESSSEEEEETTEEEE S EEEEEE:    
ExpBur          :bebbbbeebbebeebbebbeeebeeeeebebbbbebebebbbbbbeeeeeebbeeebebbbbbeeeeeebebebbbbeeebbbbebeeeeeeeebebebb:    
Contact         :                                                              b                                     

queryA      1865:DVFYKENSYTTTIK:1878
                :**************:
8cx9_B_1     307:DVFYKENSYTTTIK: 320
SecStr          :EEEEE SEEE    :    
ExpBur          :bbbbebeebebeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123