#WARNING:no index is registered index "YP_009724389.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009724389.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein. [pdbjlvh2]Protein Model on 7re3_F_1_J_1

Protein Model on 7re3_F_1_J_1 (TEMPLATE: 7re3 )

CurrentView:HTML5 Change to:[JAVA] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) F 1 (F) polymer(polypeptide(L)) [590 aa] Helicase :R1AB_SARS2
2 b J 1 (G) polymer(polypeptide(L)) [927 aa] RNA-directed RNA polymerase :R1AB_SARS2 5481V 5510R 5513K 5517V 5519I 5540T 5541Y 5542K 5668D 5669K (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:7re3_F_1 identity=100.0%
queryA      5325:AVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGS:5424
                :****************************************************************************************************:
7re3_F_1       5:AVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGS: 104
SecStr          :  EE TTT  EE EEETTSSS  EE HHHHHHHHHHSS   EE SSB S  SSS     GGG EEETTEEE TTT  SS  BSSBTTB   S TTS    :    
ExpBur          :eeeebbbeebebbbebbebeeebbbbbebbeebbeebebeebbeeeebebebeeeebebbeebbbbeebbebeeeeeeeeeebbeeeebebeeeeebeee:    

queryA      5425:DNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTF:5524
                :****************************************************************************************************:
7re3_F_1     105:DNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTF: 204
SecStr          :STHHHHHHHHS  S BHHHHHHSSSS HHHHHHHHHHHHHHHHHHHTSS  EEE S   SSEE EE  TTS      TTS EE  EEETTEEE   EEB :    
ExpBur          :eebeebbebbebebeebebbeebbebeeebbbbbbbbbbbbebeeeeeebebebeeeeeeebbebeeeeeeeebebbeeeebbbbbeeeeeeeebbbbbb:    
Contact         :                                                        b                            b  b   b b     

queryA      5525:EKGDYGDAVVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYP:5624
                :****************************************************************************************************:
7re3_F_1     205:EKGDYGDAVVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYP: 304
SecStr          :   SSSS EE B   SS   TTBEEB          S SS    B SS  S    SS  STTGGGHHHHHHHHHBSEEEEE  SSS HHHHHHHHHHHST:    
ExpBur          :eebeeeebbeeebbbeeebeeebebebbeeebeebebebbeeeeeeeebeebeeeeeeeeebeebeeebeebbebbbbbbbbbbebeeeebbbbbbebbe:    
Contact         :               bbb                                                                                  

queryA      5625:SARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYIG:5724
                :****************************************************************************************************:
7re3_F_1     305:SARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYIG: 404
SecStr          :TS EEEEESSHHHHHHHHHHHHHTS STTEEE   SS  S    SSS S TT SEEEEEGGG  SEE SEEEEE TTT  HHHHHHHHHHEE SEEEEEE:    
ExpBur          :ebbbbbbbbbbeebeebbebbeeebeeeebbbbeeeeebbebeeebeeebeebbbbbbbbeebeebebebbbbbbbbbbebbbbbbbbeebebebbbbbb:    
Contact         :                                           bb                                                       

queryA      5725:DPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFL:5824
                :****************************************************************************************************:
7re3_F_1     405:DPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFL: 504
SecStr          : TTS     TT  BS   GGGG HHHHHHHHS  SEE    SSS HHHHHHHHHHTSSS    SS   S EEEEE        SSS   HHHHHHHHHSS:    
ExpBur          :bbbbeebebebbeeeebeebbbbbbbeebeeeeeebebeebebbbeebbebbbeeebeebbeeeeeeeeebbbbebebeeeeeeeebbbeebbeebeeeb:    

queryA      5825:TRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKVGILCIMSDRDLYDKLQFTSL:5914
                :******************************************************************************************:
7re3_F_1     505:TRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKVGILCIMSDRDLYDKLQFTSL: 594
SecStr          :SS  S SS EEEES HHHHHHHHHHS   EEEGGG SS  EEEEEEE    SSTTT HHHHHHHHTSEEEEEEEEE  SSSSSSS  B  :    
ExpBur          :eebeebeebbbbbbbebbbeebeeebebebebbeebeeeebeebbbbbbeeeeebeeeeebbbbbbbbeebbbbbbebeebeeebebeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123