#WARNING:no index is registered index "YP_009724389.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009724389.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein. [pdbjlvh2]Protein Model on 7rdy_A_1_H_1

Protein Model on 7rdy_A_1_H_1 (TEMPLATE: 7rdy )

CurrentView:HTML5 Change to:[JAVA] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [927 aa] RNA-directed RNA polymerase :R1AB_SARS2
2 b H 1 (T) polymer(polyribonucleotide) Template RNA 4800Q 4888N 4892K 4893S 4899N 4933Q 4935N 4937K 4949V 4950A 4951G 4961R 4969K 4972A 4982G 4984S 4986F 4987Y 5074S 5075G 5076D 5077A 5078T 5079T 5081Y 5252V 5253S 5256I 5306R 5307Y 5312F 5316M (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:7rdy_A_1 identity=100.0%
queryA      4395:DAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFF:4494
                :****************************************************************************************************:
7rdy_A_1       3:DAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFF: 102
SecStr          : TTHHHHHHHTTS  EEEESSSSS    EE   EEESSS EEE   EE S  EEEEE TTS EEEEEEE  B  HHHHHHHHHHHHHSTT SSB  EEEE:    
ExpBur          :eeeebbeebbeebebebeeeeeeeeeeebebbebeeeeebbbbbbbebeebbbbbbbeeeeeeeebbbbbbbeeeebbeebeebbeebeebebbbebbbb:    

queryA      4495:KFRIDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAMRNAGIV:4594
                :****************************************************************************************************:
7rdy_A_1     103:KFRIDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAMRNAGIV: 202
SecStr          :EEESSSSEEEEEEEEEE SSBHHHHHHHHHS  TTS HHHHHHHHHTTSS SSGGGSTTTT TTT TTHHHHHHTTHHHHHHHHHHHHHHHHHHHTTTEE:    
ExpBur          :ebebeeeeebbbbbbebbbbbbbbbbbbbbbbeeeebebbeebbeebebbeeebbeeebbbbbbebeebbebbbebbeebbebbeebbebbebbeebbbe:    

queryA      4595:GVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVNCL:4694
                :****************************************************************************************************:
7rdy_A_1     203:GVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVNCL: 302
SecStr          :EE  GGGBBTTS B   SS EE STT   EE HHHHHHHTTHHHHTTTTTTSSBGGG TTS B    TT    HHHHHHHHHHSSTT  S   SSGGG S:    
ExpBur          :bebbbbbbbbebbbbebeebeeeeeeebebebbbbbbbbbbbbbbbebbebbbbeeeeeeeeeeeeeeeeeebbeebeebbeebbeebebebbbbbeebe:    

queryA      4695:DDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALT:4794
                :****************************************************************************************************:
7rdy_A_1     303:DDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALT: 402
SecStr          :STTSHHHHHHHHHHHTTSS GGG B  EEEEEETTEEEEEE EEEETTTEEEE S   SEE    HHHHHHHHHSHHHHHHTSEE   TT SS EEEE S:    
ExpBur          :ebbbbbbbbbbbbbbbebbeeebbbebeeebebeeeeeebbbbbbbebbbbbebeeeeeebeebeebeebbbebbbbeeeeeeeebebeebebebebbee:    

queryA      4795:NNVAFQTVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSA:4894
                :****************************************************************************************************:
7rdy_A_1     403:NNVAFQTVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSA: 502
SecStr          :SS     B   EE HHHHHHHHHTT S TT SS    B   B STTHHHHGGGGGG       HHHHHHHHHHHHHHT S       TTS   S S SB :    
ExpBur          :eeeeeeebeeeeebeebeebbeeeebbeeebebeeebebeebeeebbbebbbebebbeebbbbbbbbbbbbbbbbebbeebebbebebeebebeeeeeeb:    
Contact         :     b                                                                                       b   bb 

queryA      4895:GFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHNML:4994
                :****************************************************************************************************:
7rdy_A_1     503:GFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHNML: 602
SecStr          : TTGGGT BHHHHHHHS HHHHHHHHHHHTTS    EEEEEE    BSS S  EEEE  HHHHHHHHHHHHHHHHHHTT SSSSB SS  STTTHHHHHH:    
ExpBur          :bbbbeeeeebeebbeebeeeebeebbebbbebbbbbbbebebeeebbeeeebebebebbbbbbbbbebbbbebbebbeeeeebbbbbebeeeebbbbebb:    
Contact         :    b                                 b b b           bbb         b       b  b         b b bb       

queryA      4995:KTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTA:5094
                :****************************************************************************************************:
7rdy_A_1     603:KTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTA: 702
SecStr          :HHHTSS SSEEEEE   TTHHHH  HHHHHHHHHHTTSS SSSS HHHHHHHHHHHHHHTTS EEE SS EEE  SS  TTSSSSHHHHHHHHHHHHHHH:    
ExpBur          :eebbeebeeeebbbbebbebebbbbbbbbbbbbbbbbbbbeeebeeeebbbbbbbbbbbbbbbbbbbebbbbebebbbbeebebeebbbbbbbbbbbbbb:    
Contact         :                                                                               bbbbbb b             

queryA      5095:NVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMMILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTE:5194
                :****************************************************************************************************:
7rdy_A_1     703:NVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMMILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTE: 802
SecStr          :HHHHHHSS SSS   HHHHHHHHHHHHHHHS SS  HHHHHHHHHHHHHHEEEEEETTEEEEEEEHHHHHHTSS  HHHHHHHHHHHHS    TTS EEE:    
ExpBur          :bbbbbbebbbeebeeeebeebbbebbebbbeeeeeeeebbeebbebbeebbbbbbebeebbbbbbeebbeeebbbbbebbbbbbbbbbbbbbeeeebbeb:    

queryA      5195:TDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDM:5294
                :****************************************************************************************************:
7rdy_A_1     803:TDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDM: 902
SecStr          :  GGG  S BTTBEEEEEEETTEEEEEEE  HHHHHHHHHEESSGGGGSSTT SHHHHHHHHHTGGGGGSSSHHHHHHHHHHHHHHHHHHHHHHHHHHHS:    
ExpBur          :eebeebbeebeebebbebebeeeebbbbbbebbebbbbbbbbeeeeeeebbeebeebbebbbebbbbeebeeeebbebbebbbebbeebbeeeeeeeeee:    
Contact         :                                                         bb  b                                      

queryA      5295:YSVMLTNDNTSRYWEPEFYEAMYTPHT:5321
                :***************************:
7rdy_A_1     903:YSVMLTNDNTSRYWEPEFYEAMYTPHT: 929
SecStr          :SSS  SS  GGGTTSHHHHHTTSSTT :    
ExpBur          :eeeeeeeeebeeebeeeebeebbeeee:    
Contact         :           bb    b   b                                                                              


Input Residue Numbers for Focused Sites

ex) 2,15,123