#WARNING:no index is registered index "YP_009724389.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009724389.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein. [pdbjlvh2]Protein Model on 7n0d_B_1_K_1

Protein Model on 7n0d_B_1_K_1 (TEMPLATE: 7n0d )

CurrentView:HTML5 Change to:[JAVA] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [512 aa] Proofreading exoribonuclease :R1AB_SARS2
2 b K 1 (H) polymer(polypeptide(L)) [512 aa] Proofreading exoribonuclease :R1AB_SARS2 6069D 6070Q 6179Q 6191N 6329R 6358K 6366Q 6394K 6395S 6396A 6397T 6440D 6441T 6442Y (identity: 100.0 %/97.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:7n0d_B_1 identity=97.9%
queryA      5927:ENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAV:6026
                :****************************************************************************************************:
7n0d_B_1       2:ENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAV: 101
SecStr          :    STT B B  SS B STT SSGGGB TTTEETTEE   TTS   SS  EEE           TTS  SB  HHHHHHTGGGEEEEEEEEEEE SSB :    
ExpBur          :eeeeeeeeebbeeeeebbeeebeeeeebbeebeeeeeeeeeeeeeeeeebebbbbbeeeeeebeeeeeeebebeeeebbebbbbbbbbbbbbbebeeebe:    

queryA      6027:GTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKI:6126
                :***************************************************************************************** **********:
7n0d_B_1     102:GTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFALTSMKYFVKI: 201
SecStr          :S EEEEEEEESSS EEEB  EEEEE SSSEEEEE  EE  SSSTTGGGGGGTTS B HHHHHHHHHHHHHHHHTTT SS EEEES HHHHHHHHHHHB  :    
ExpBur          :ebebbbbbbbbeeeebbbebbbbbbbbeeeeebebebeebeeeebeebeebbeeeeebeebbeebbebbbeebeebbebbbbbbbeeebbbbbbebbbee:    
Contact         :                                          bb                                                        

queryA      6127:GPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGD:6226
                :****************************************************************************************************:
7n0d_B_1     202:GPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGD: 301
SecStr          : S  B TTS SB  EE SSS  EE SSS SS  EESS EEEEGGGTT  S HHHHHTTT SS   TTSHHHHHHHHHHHHHHHHHTS   SS      SS:    
ExpBur          :beeeebeeeeebbbbbbeeeeebbbbeebeebbbbbbbbbbbbeebebeeebeebbeeebeeeeeeebbbbbbebbbbbbbbbbbeeeeeeeeebeeeee:    
Contact         :                                                    b           b                                   

queryA      6227:ELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRF:6326
                :****************************************************************************************************:
7n0d_B_1     302:ELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRF: 401
SecStr          :HHHHHHHHHHHHHHHHHHHHHTT  SBEEEET  SS  SSS  SSB  EEESS  S  STTEEE    TTTSSSSS SSEEEEES   S   SSEEEEEE:    
ExpBur          :beebeebbeebbebbbbbbbebeebebbbbbebeeeeebbeeeebebebbbeeebeeeeeebeebebbeeeeeeebeebbbbbbebebeebbebbbbbbb:    

queryA      6327:DTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNMM:6426
                :*****************************************************          *************************************:
7n0d_B_1     402:DTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESXXXXXXXXXXYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNMM: 501
SecStr          : TT   SSEEE STT EEEESSSEEEE    GGGGTTEEE    EE  S    ----------      S EESHHHHSSS  HHHHHHHHHHHHHHHHH:    
ExpBur          :bbeeeeebbbebbeebbbbbbebbeebeebeeebbeebeebeebbbbeeeeee----------eeebeeeebbbebeeeeebbeebbeebeebeebbeeb:    
Contact         :  b                            b       b                           bbbb                             

queryA      6427:ISAGFSLWVYKQFDTYNLWNTF:6448
                :**********************:
7n0d_B_1     502:ISAGFSLWVYKQFDTYNLWNTF: 523
SecStr          :HHHTEEEEEETT  THHHHH  :    
ExpBur          :eebbbebbbbeebeeeebeeee:    
Contact         :             bbb                                                                                    


Input Residue Numbers for Focused Sites

ex) 2,15,123