#WARNING:no index is registered index "YP_009724389.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009724389.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein. [pdbjlvh2]Protein Model on 6xez_E_1_T_1

Protein Model on 6xez_E_1_T_1 (TEMPLATE: 6xez )

CurrentView:HTML5 Change to:[JAVA] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) E 1 (E) polymer(polypeptide(L)) [596 aa] Helicase :R1AB_SARS2
2 b T 1 (E) non-polymer(MG) MAGNESIUM ION 5612K 5613S 5698D (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6xez_E_1 identity=100.0%
queryA      5325:AVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGS:5424
                :****************************************************************************************************:
6xez_E_1       5:AVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGS: 104
SecStr          :  EE TTT  EE  EESSSSS  B  HHHHHHHHHSSS   EE SSB S  STT     GGGEEE SSS EESTT  SS EESEETTEE  TT TT    :    
ExpBur          :eebebbbbebebbbebbebeeebebbbebbeebbeebebeebbbeeebebebeebeeeebeebeebeeeeebeeeebeebeebeeeeebebeeeeebeee:    

queryA      5425:DNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTF:5524
                :****************************************************************************************************:
6xez_E_1     105:DNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTF: 204
SecStr          :S HHHHHHHHH  S BTHHHHHHTTS HHHHHHHHHHHHHHHHHHHTTS  EEEEEE SSS EEEEE TTS     STT  EEEEE  SS  EEEEEEE :    
ExpBur          :eeeeebbebbeeebbeeebbeebbebeeebbbbbbbbeebbbeeeeeebeebebeeeeeeeebbbbeeeeeeeeebeeeeebbbeeeeeeeeeebbebbb:    

queryA      5525:EKGDYGDAVVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYP:5624
                :****************************************************************************************************:
6xez_E_1     205:EKGDYGDAVVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYP: 304
SecStr          : B SSSSEE  EESS     SSEEEEE         S SS      SS  S    SS  GGG TTHHHHHHHHHSSEEEEE  TTSSTTHHHHHHHHHSS:    
ExpBur          :ebbeeeebbebeeeeeeebeeebebbebeeebeeeeeebbbeeeeeeeeeebeebeeebeebeebeebbebbbebebbbbbbbbbbebeebbbbbbebbe:    
Contact         :                                                                                       bb           

queryA      5625:SARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYIG:5724
                :****************************************************************************************************:
6xez_E_1     305:SARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYIG: 404
SecStr          :SS EEEEES HHHHHHHHHHHHHHS S  EE   SS  SS    SS SS S  SEEEEEGGG    B SEEEEE TTT  HHHHHHHHHH B SEEEEEE:    
ExpBur          :ebbbbbbbeebebbebbbeebbeebeeebbbbbbeeebeeebbeeeeeeeeebbbbbbbbeebeeeebbbbbbbbbbbbebbebbbbbeebebebbbbbb:    
Contact         :                                                                         b                          

queryA      5725:DPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFL:5824
                :****************************************************************************************************:
6xez_E_1     405:DPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFL: 504
SecStr          : TTS     TT  BS   GGGGSHHHHHHTTT  S B     SS HHHHHHHHHTTS S    S     EEE          SSSS   HHHHHHHGGGT:    
ExpBur          :bbbbbebebebbeeeebeebebbbbbbebeeeeeebeeeebbbbbbebbebbbebebeeebebeeeeeebbbbebebeebeeeeebbbbeebbbbeeeee:    

queryA      5825:TRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKVGILCIMSDRDLYDKLQFTSLEIPRRN:5920
                :************************************************************************************************:
6xez_E_1     505:TRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKVGILCIMSDRDLYDKLQFTSLEIPRRN: 600
SecStr          :SS SS  S EEE SSHHHHHHHTTS SS B  TTT SS  BSSEEEB   S TTTT HHHHHHHHTTBSS EEEB   SSHHHHS S    SS   :    
ExpBur          :eebeeeeebbbbbbeebbbebbeeeeeeebeebebbbeebeebbbbbbbeeeeebeeeebbbbbbbbbeebbbbbbbbeebeeebeeeeeebeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123