#WARNING:no index is registered index "YP_009724389.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009724389.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein. [pdbjlvh2]Protein Model on 5sm1_A_1_G_1

Protein Model on 5sm1_A_1_G_1 (TEMPLATE: 5sm1 )

CurrentView:HTML5 Change to:[JAVA] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (D) polymer(polypeptide(L)) [459 aa] Proofreading exoribonuclease nsp14 :R1AB_SARS2
2 b G 1 (D) non-polymer(WH1) N-methyl-N-[2-(pyridin-2-yl)ethyl]benzamide 6243K 6246L 6247L 6250K 6251F 6268Q 6269A 6270D 6271V (identity: 100.0 %/91.6 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5sm1_A_1 identity=91.6%
queryA      5949:PTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTG:6048
                :************************************************************************      ********************* :
5sm1_A_1      20:PTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHXXXXXXGTNLPLQLGFSTGVNLVAVPTX: 119
SecStr          :  S  TTSB   GGGTTTSTT  SS BHHHHHHHTT   TT  SS   SB  HHHHHHTGGGEEEEEEEE  ------  SS EEEEETTSEEEEEE  -:    
ExpBur          :eeebebeeebebeebeeeeeebeeebbbeebbeebebebeebeeebebbbbbeebbbebbbbbbbbbbeeee------eeeeebbbbbeebbbbbbeee-:    

queryA      6049:YVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDT:6148
                :                           *************************************************************************:
5sm1_A_1     120:XXXXXXXXXXXXXXXXXXXXXXXXXXXPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDT: 219
SecStr          :--------------------------- EE   EEHHHHHHHHHHHHHHHHTTT SS EEEE   SHHHHHGGGTEE  S  B SSSSSB  EEETTTTE:    
ExpBur          :---------------------------eeeeeeeebeebbeebbebbbeebeebbebbbbbbbbbbebbebbeebbebbeeeebeebeebbbbbbeeeee:    

queryA      6149:YACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDELKINAACRKVQHMVVKAALLA:6248
                :****************************************************************************************************:
5sm1_A_1     220:YACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDELKINAACRKVQHMVVKAALLA: 319
SecStr          :EE TTS TT  EEES EEEEGGGGT  S HHHHHTTT SS    SSHHHHHHHHHHHHHHHHHTSS  TT      SSHHHHHHHHHHHHHHHHHHHHHH:    
ExpBur          :bbbbeebeebbbbbbbbbbbbeebeeeeebeebbeeebeeeeeeebbbbbbebbbbbbbbbbbbeeeeeebebeeeeebeebeebbeebbebbbbbbbeb:    
Contact         :                                                                                              b  bb 

queryA      6249:DKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNK:6348
                :***********************************************  ***************************************************:
5sm1_A_1     320:DKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYXXHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNK: 419
SecStr          :H  SEEEEEE TT   SSTT  SEEEEEE    SSS B HHHHH   --  S TTSSEEEEES  BSS  SSEEEEEE TT  SSSEEE STT EEEESS:    
ExpBur          :eebebbbbbbeeeeeebbeeeebebeebebeebbeeeeebeeebeee--eeebbeebbbbbbebbbeebeebbbbbbbbbeeeeebbbebbeebbbbbbe:    
Contact         : bb                bbbb                                                                             

queryA      6349:HAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTF:6448
                :*********************************      *************************************************************:
5sm1_A_1     420:HAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGXXXXXXIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTF: 519
SecStr          :SEEEE    GGGGTTEEE    EE  S      ------        TTEESHHHHTTS  HHHHHHHHHHHHHHHHHHHTTEEEEEETT  GGGGGGG :    
ExpBur          :ebebbbebeeebbeebeebeebbbbeeeeeeee------eeeeebeeeebbbebeeeeebeeebbeebeebeebbeebeebbbbbbbbeebeeeebbeeb:    

queryA      6449:T:6449
                :*:
5sm1_A_1     520:T: 520
SecStr          : :    
ExpBur          :e:    


Input Residue Numbers for Focused Sites

ex) 2,15,123