#WARNING:no index is registered index "YP_009724389.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009724389.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein. [pdbjlvh2]Protein Model on 5sl1_A_1_G_1

Protein Model on 5sl1_A_1_G_1 (TEMPLATE: 5sl1 )

CurrentView:HTML5 Change to:[JAVA] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (D) polymer(polypeptide(L)) [461 aa] Proofreading exoribonuclease nsp14 :R1AB_SARS2
2 b G 1 (D) non-polymer(O2A) N-methyl-1H-indole-7-carboxamide 6276Y 6291L 6292F 6293Y 6294S 6299S 6300D 6302F (identity: 100.0 %/92.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5sl1_A_1 identity=92.0%
queryA      5949:PTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTG:6048
                :************************************************************************      ********************* :
5sl1_A_1      20:PTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHXXXXXXGTNLPLQLGFSTGVNLVAVPTX: 119
SecStr          :  S  TTSB   GGGTTTSTT  SS BHHHHHHHHT    S  SS   SB  HHHHHHTGGGEEEEEEE   ------  SS EEEEETTSEEEEEE  -:    
ExpBur          :eeebebeeebebeebeeeeeebeeebbbeebbeebebebeebeeebebbbbbbebbbebbbbbbbbbbeeee------eeeeebbbbbeebbbbbbeee-:    

queryA      6049:YVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDT:6148
                :                           *************************************************************************:
5sl1_A_1     120:XXXXXXXXXXXXXXXXXXXXXXXXXXXPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDT: 219
SecStr          :--------------------------- EE   EEHHHHHHHHHHHHHHHHTTT SS EEEE   SHHHHHGGGTEE  S  B SSSSSB  EEETTTTE:    
ExpBur          :---------------------------eeeeeeeebeebbeebbebbbeebeebbebbbbbbbbbbebbebbeebbebbeeeebeeeeebbbbbbeeeee:    

queryA      6149:YACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDELKINAACRKVQHMVVKAALLA:6248
                :****************************************************************************************************:
5sl1_A_1     220:YACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDELKINAACRKVQHMVVKAALLA: 319
SecStr          :EE SSS TT  EEES EEEEGGGGT SS HHHHHHTT SS    SSHHHHHHHHHHHHHHHHHTSS  SS      SSHHHHHHHHHHHHHHHHHHHHHH:    
ExpBur          :bbbbeebeebbbbbbbbbbbbeebeeeeebeebbeeebeeeebeebbbbbbebbbbbbbbbbbbeeeeeebebeeeeebeebeebbeebbebbbebbbeb:    

queryA      6249:DKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNK:6348
                :****************************************************************************************************:
5sl1_A_1     320:DKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNK: 419
SecStr          :H  SEEEEEE TT   SSTT  SEEEEEE    SSS B TGGGG  TTS     SSSEEEEES  BSS  TTEEEEEE TT  SSSEEE STT EEEESS:    
ExpBur          :eebebbbbbbeeeeeebbeeeebebeeeebeebbeeeeebeeeeeeeeeeeeebeebbbbbbebbbeebeebbbbbbbbbeeeeebbbebbeebbbbbbe:    
Contact         :                           b              bbbb    bb b                                              

queryA      6349:HAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTF:6448
                :*********************************      *************************************************************:
5sl1_A_1     420:HAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGXXXXXXIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTF: 519
SecStr          :SEEEE    GGGGTTEEE    EE  S      ------        TTEESHHHHTTS  HHHHHHHHHHHHHHHHHHHTTEEEEEETT  GGGGGGG :    
ExpBur          :bbebbbebeeebbeebeebeebbbbeeeeeeee------eeeeebeeeebbbebeeeeebeeebbeebeebeebbeebeebbbbbbbbeebeeeebeeeb:    

queryA      6449:T:6449
                :*:
5sl1_A_1     520:T: 520
SecStr          : :    
ExpBur          :e:    


Input Residue Numbers for Focused Sites

ex) 2,15,123