#WARNING:no index is registered index "YP_009724389.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009724389.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein. [pdbjlvh2]Protein Model on 5rmd_A_1_C_1

Protein Model on 5rmd_A_1_C_1 (TEMPLATE: 5rmd )

CurrentView:HTML5 Change to:[JAVA] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [572 aa] Helicase :R1AB_SARS2
2 b C 1 (A) non-polymer(VWY) N-ethyl-4-[(methylsulfonyl)amino]benzamide 5330V 5345R 5347P 5453R 5456L 5457F 5460E 5559L 5560S (identity: 100.0 %/96.6 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5rmd_A_1 identity=96.6%
queryA      5325:AVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGS:5424
                :**********************************************************************************************      :
5rmd_A_1       1:AVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKXXXXXX: 100
SecStr          :  EE TTT  EES EESSSTT  B  HHHHHHHHTTSS   EESSSBS   STT     GGGEEEETTEEEETTT  SSEEESEETTEE  S  ------:    
ExpBur          :eeeebebeeeebbbebbebeeebebbbebbeebbeebebeebbbeeebebebeebeeeebeebeebeeebebeeeeeeebeebbeeeebebeee------:    
Contact         :     b              b b                                                                             

queryA      5425:DNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTF:5524
                :  ***********************************************************************************        *******:
5rmd_A_1     101:XXVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYXXXXXXXXQIGEYTF: 200
SecStr          :-- HHHHHHHH  S BHHHHHHHHHS HHHHHHHHHHHHHHHHHHHTTS  EEEEE  SSSEEEEEE TTS     SSSS EEE --------   EEEE:    
ExpBur          :--eeebbebbebebbebebbebbbebeeebbbbbbbbbebebbeeeeebbebebeeeeeeeebbbeeeeeeeebeebeebebbbe--------ebeebeb:    
Contact         :                            b  bb  b                                                                

queryA      5525:EKGDYGDAVVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYP:5624
                :**    **********************************************************************************************:
5rmd_A_1     201:EKXXXXDAVVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYP: 300
SecStr          :E ----  EEEEESS     TT EEEE         S SS    B SS  S    S   GGGGGGHHHHHHHHTBSEEEEE  TTSSHHHHHHHHHHHST:    
ExpBur          :ee----eebebeeeeeeebeeeeebebeeeebeebebebbbeeeeeeeeeebeeeeeeeeebeebeeebeebbebbbbbbbbbbebebebbbbbbbebbe:    
Contact         :                                  bb                                                                

queryA      5625:SARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYIG:5724
                :****************************************************************************************************:
5rmd_A_1     301:SARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYIG: 400
SecStr          :T  EEEE SSHHHHHHHHHHHHHHS GGGEEE   SS  S    SSEES TTSSEEE  GGG  SEEEEEEEE  GGG  HHHHHHHHHHEEEEEEEEEE:    
ExpBur          :ebbbbbbbeebebbeebbeebeebbeeeebbbbbeeeeeeebbeebeeeeeeebbbbbbbeebeebebebbbbbbbbebebbbbbbbbeebebebbbbbb:    

queryA      5725:DPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFL:5824
                :****************************************************************************************************:
5rmd_A_1     401:DPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFL: 500
SecStr          : TTS     TT  BS   GGGS HHHHHHHHT  SEE  EESSS HHHHHHHHHHHSTT  EE S   S EEEEE     EEETTEEE HHHHHHHHHHH:    
ExpBur          :bbbbbbbebebbeeeebebebbbbbbeebeeeeeebebeebebbbbbbbebbbebbbeeebeeeeeeeeebbbbeeeeeeeeeeeebbbeebbbbbeebb:    

queryA      5825:TRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKVGILCIMSDRDLYDKLQFTSLEI:5916
                :********************************************************************************************:
5rmd_A_1     501:TRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKVGILCIMSDRDLYDKLQFTSLEI: 592
SecStr          :HH GGGGG EEEES HHHHHHHHHHH   EEEHHHHTT  EEEEEEE  S SHHHH HHHHHHHHTTEEEEEEEEES HHHHHH  SEE   :    
ExpBur          :eeeeebeebbbbbbbebbbebbeeebebeeebbeebbeeebebbbbbbbbeeeebeeebbbbbbbbbbeebbbbbbbbeebbeebebeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123