Protein Model on 6mi3_A_1_B_1 (TEMPLATE: 6mi3 )

CurrentView:HTML5 Change to:[JAVA] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(NEMO_HUMAN) A 1 (A) polymer(polypeptide(L)) [122 aa] NF-kB ESSENTIAL MODULATOR,NF-kappa-B essential modulator,NF-kB ESSENTIAL MODULATOR :NEMO_HUMAN
2 b B 1 (B) polymer(polypeptide(L)) [124 aa] NF-kB ESSENTIAL MODULATOR,NF-kappa-B essential modulator,NF-kB ESSENTIAL MODULATOR :NEMO_HUMAN 41L 42P(K) 44E 45Q(V) 47A(L) 48P(K) 50T(L) 51L 54C 55L 58N 61L 62R 64A 65I 68S 69N 72L 79L 83Q 86Q 93L 94M 96K 97F 100A 103L 104V 107L 110E 111K 114L 115K(E) 117Q(K) 118K(N) 121A(L) 122L 124E 125V(I) 128L 129K (identity: 75.6 %/75.6 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6mi3_A_1 identity=75.6%
queryA        40:HLPSEQG-APETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLK: 129
                :**  *       *****  ****************** ****************** ***************** *    *  * *  ***:
6mi3_A_1      21:HLKNEVARLKKLLQRCLAANQELRDAIRQSNQILRERAEELLHFQASQREEKEFLMSKFQEARKLVERLGLEKLELEDKNEELLSEIAHLK: 111
SecStr          :HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH:    
ExpBur          :eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee:    
Contact         : bb bb  bb bb  bb  b  bb bb  bb  b      b   b  b      bb bb  b  bb  b  bb  bb bb  bb bb  bb         


Input Residue Numbers for Focused Sites

ex) 2,15,123