Protein Model on 3fx0_A_1_B_1 (TEMPLATE: 3fx0 )

CurrentView:HTML5 Change to:[JAVA] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(NEMO_HUMAN) A 1 (A) polymer(polypeptide(L)) [63 aa] NF-kappa-B essential modulator :NEMO_HUMAN
2 b B 1 (B) polymer(polypeptide(L)) [71 aa] NF-kappa-B essential modulator :NEMO_HUMAN 267L 270A 273A 274L 277K 281I 284L 291H 294V 295M 298V 301L 302K 305A 308Y 309K 311D 312F 315E 316R 319R 322L 323A 325K 329L (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3fx0_A_1 identity=100.0%
queryA       267:LQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELL: 329
                :***************************************************************:
3fx0_A_1      26:LQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELL:  88
SecStr          :  SSTTTTTTTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSSTTS  :    
ExpBur          :eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee:    
Contact         :b  b  bb  b   b  b      b  bb  b  bb  b  bb bb  bb  b  bb b   b                                     


Input Residue Numbers for Focused Sites

ex) 2,15,123