Protein Model on 6wx9_A_1_B_1 (TEMPLATE: 6wx9 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [424 aa] Importin subunit alpha-5 :IMA5_HUMAN
2 b B 1 (B) polymer(polypeptide(L)) [15 aa] Transcription factor SOX-2 :SOX2_HUMAN 101R 105S 138F 142W 146N 148A 149S 150G 151T(N) 155T 181Q 184W 188N 191G 192D 231W 235N 238R 315R 319N 321V 322T 323G 328T 357W 360S 361N 364A 396E 399W (identity: 96.7 %/50.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6wx9_A_1 identity=50.8%
queryA        80:DIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA-GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHI: 178
                :*    * *   * ** ***  ***** *  ****  *   *    ** ** *      ****** ******* * **  *   ** * ** ** *     :
6wx9_A_1      15:DMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDV: 114
SecStr          :HHHHHHH S HHHHHHHHHHHHHHH  SS   HHHHHTSTTSHHHHHHHTT TT HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHHT S HHH:    
ExpBur          :ebeebbeeeeeeebeebbeebbeebeeeeeebbeebeeeeebbebbbebbebeeeeebbebbbebbbbbbeeeeebbeebbeeebbebbbebbebeeeeb:    
Contact         :                     b   b                                 b   b   b bbbb   b                       

queryA       179:SEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYL: 278
                : *************    ** *       *** *              **  * ****** * * *    *   *  *  **   *  **** *** ***:
6wx9_A_1     115:QEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMT----RNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYL: 210
SecStr          :HHHHHHHHHHHHTS HHHHHHHHHTT HHHHHGGGG  S HHHH----HHHHHHHHHHH   SS   HHHHGGGHHHHHHHTT S HHHHHHHHHHHHHH:    
ExpBur          :bbbbbebbbbbbeeeeebbeebbeeebbebbeebbeeeebeebb----ebbbebbbbbbeeeeeebeeeebeebbebbbebbeeebeebbbebbebbbeb:    
Contact         :  b  b   b  bb                                      b   b  b                                        

queryA       279:TDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGL: 378
                : ****  *  *   **   ** **       * ***** ****** * ****     **     **  **  * *** ** ******   *** *     :
6wx9_A_1     211:SDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANI: 310
SecStr          :TSSSHHHHHHHHHT  HHHHHHHHT SSHHHHHHHHHHHHHHTTS HHHHHHHHHTT HHHHHHHTT S HHHHHHHHHHHHHHHTS HHHHHHHHHTT :    
ExpBur          :beeeeebbeebbeeebbeebbebbebeeeebbbbbbebbbbbbeeeeebbeebbebebbebbeebbebeeeebeebbbebbbebbebeeebbeebbeeeb:    
Contact         :                                    b   b bbb    b                            b  bb  b              

queryA       379:VPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKI: 473
                : * * * *  * * * *** ** ** ****  *** ***  * * **  ***  * **  * *    **    *         *      ***  *****:
6wx9_A_1     311:FPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKI: 410
SecStr          :HHHHHHHHHHS HHHHHHHHHHHHHHHHS  TTHHHHHHHHT HHHHHHGGGSS HHHHHHHHHHHHHHHHHHHHHHHH SSSS THHHHHHHTTHHHHH:    
ExpBur          :bebbbebbeebeeebebbbbebbbbbbeebbeebbebbbeeebbebbbebbeeeeeebbebbbebbebbbebbeeebeeeeeeebebbeebeebebeeeb:    
Contact         :                 b  b                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123