Protein Model on 6wx8_A_1_E_1 (TEMPLATE: 6wx8 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [419 aa] Importin subunit alpha-3 :IMA3_HUMAN
2 b E 1 (A) non-polymer(SO4) SULFATE ION 76W(T) 77S 78V(L) 79D(E) (identity: 25.0 %/54.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6wx8_A_1 identity=54.3%
queryA        75:NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP: 174
                :* *   **    * *   ** * ********    ****  *  *  *  *  * * *    *** *************** ***   * * *  ** **:
6wx8_A_1       8:NTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSP: 107
SecStr          :TS HHHHHHHHT S HHHHHHHHHHHHHHHHSSSS  HHHHHHTT HHHHHHHTT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHHTT S:    
ExpBur          :eeebeebbeebeeeeeeebeebbeebbebbeeeeeebbeebeeeebbebbbebbeeeebeebbbbbbebbbebbeeeeebbebbbeeebbebbbebbebe:    
Contact         : bbbb                                                                                               

queryA       175:HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWA: 274
                :*    ********** ***   ** **  * * ***         *     *** **   **** * * **      *** *  * ** *   * ** **:
6wx8_A_1     108:HQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWA: 203
SecStr          : HHHHHHHHHHHHHHHTT HHHHHHHHHHT HHHHHHT S----TTS HHHHHHHHHHHHHHT   SS   HHHHHHHHHHHHHHTT S HHHHHHHHHH:    
ExpBur          :eeebbebbbebbbbbbeebeebbeebbeeebbebbbebbe----eebeeebbebbbebbbbbbeeeeeebeeebbeebbebbbebbeeebeebbbebbeb:    

queryA       275:ISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV: 374
                : *****  ** * **   * ** ** **   *    * **** **************    **  ** *** **  * *** *  ****** * * * * :
6wx8_A_1     204:LSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVI: 303
SecStr          :HHHHHTS HHHHHHHHHTT HHHHGGGGG SSHHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHHT S HHHHHHHHHHHHHHHTS HHHHHHHH:    
ExpBur          :bbebbebeeebbebbbeeebbeebbebbeeeeeebbebbbebbbbbbebeeebbbebbeeebbebbeebbebeeeebbeebbebbbebbebeeebbeebb:    

queryA       375:NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE: 474
                :   ***     * * ** ***** **  * *  *   *  **     * *  **** **     * **  ***   **   * *     ******* ***:
6wx8_A_1     304:DANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAED--EAETIGNLIEECGGLEKIE: 401
SecStr          :HTT HHHHHHHHSS  HHHHHHHHHHHHHHHHH  HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHH ST--THHHHHHHHHHTTHHHHHH:    
ExpBur          :eeebbeebbebbeeeeebbbebbbebbbbbbeebeeebbeebbeeebbebbbebbebeeeebbebbbebbbebbeebee--ebeebbeebeeebbbebbe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123