Protein Model on 6wx8_A_1_B_1 (TEMPLATE: 6wx8 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [419 aa] Importin subunit alpha-3 :IMA3_HUMAN
2 b B 1 (B) polymer(polypeptide(L)) [82 aa] Transcription factor SOX-2 :SOX2_HUMAN 101R 102K 105S 107E(D) 108K(R) 110P 142W 145T 146N 148A 149S 150G 151T 152S 155T 181Q 184W 187G 188N 191G 192D 231W 234S(V) 235N 238R 239N(H) 240K 270D 273W 277Y 280D 308P(K) 311T 315R 319N 321V 322T 323G 325D 328T 350N(K) 354E 357W 360S 361N 364A 365G 366R(N) 396E 399W 438L(Q) 442D 490S(E) (identity: 83.0 %/54.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6wx8_A_1 identity=54.3%
queryA        75:NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP: 174
                :* *   **    * *   ** * ********    ****  *  *  *  *  * * *    *** *************** ***   * * *  ** **:
6wx8_A_1       8:NTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSP: 107
SecStr          :TS HHHHHHHHT S HHHHHHHHHHHHHHHHSSSS  HHHHHHTT HHHHHHHTT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHHTT S:    
ExpBur          :eeebeebbeebeeeeeeebeebbeebbebbeeeeeebbeebeeeebbebbbebbeeeebeebbbbbbebbbebbeeeeebbebbbeeebbebbbebbebe:    
Contact         :                          bb  b bb b                               b  bb bbbbb  b                   

queryA       175:HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWA: 274
                :*    ********** ***   ** **  * * ***         *     *** **   **** * * **      *** *  * ** *   * ** **:
6wx8_A_1     108:HQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWA: 203
SecStr          : HHHHHHHHHHHHHHHTT HHHHHHHHHHT HHHHHHT S----TTS HHHHHHHHHHHHHHT   SS   HHHHHHHHHHHHHHTT S HHHHHHHHHH:    
ExpBur          :eeebbebbbebbbbbbeebeebbeebbeeebbebbbebbe----eebeeebbebbbebbbbbbeeeeeebeeebbeebbebbbebbeeebeebbbebbeb:    
Contact         :      b  b  bb  bb                                      b  bb  bbb                             b  b 

queryA       275:ISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV: 374
                : *****  ** * **   * ** ** **   *    * **** **************    **  ** *** **  * *** *  ****** * * * * :
6wx8_A_1     204:LSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVI: 303
SecStr          :HHHHHTS HHHHHHHHHTT HHHHGGGGG SSHHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHHT S HHHHHHHHHHHHHHHTS HHHHHHHH:    
ExpBur          :bbebbebeeebbebbbeeebbeebbebbeeeeeebbebbbebbbbbbebeeebbbebbeeebbebbeebbebeeeebbeebbebbbebbebeeebbeebb:    
Contact         :  b  b                           b  b   b   b bbb b  b                     b   b  b  bb  bbb        

queryA       375:NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE: 474
                :   ***     * * ** ***** **  * *  *   *  **     * *  **** **     * **  ***   **   * *     ******* ***:
6wx8_A_1     304:DANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAED--EAETIGNLIEECGGLEKIE: 401
SecStr          :HTT HHHHHHHHSS  HHHHHHHHHHHHHHHHH  HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHH ST--THHHHHHHHHHTTHHHHHH:    
ExpBur          :eeebbeebbebbeeeeebbbebbbebbbbbbeebeeebbeebbeeebbebbbebbebeeeebbebbbebbbebbeebee--ebeebbeebeeebbbebbe:    
Contact         :                     b  b                                      b   b                                


Input Residue Numbers for Focused Sites

ex) 2,15,123