Protein Model on 5mfj_B_1_D_1 (TEMPLATE: 5mfj )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (B) polymer(polypeptide(L)) [240 aa] YIII(Dq.V2)4CqI
2 b D 1 (D) polymer(polypeptide(L)) [10 aa] (KR)5 365G 366R(N) 367Q(N) 370I 406S 407G 408G(N) 409T(N) 413I 439V(E) 442D(W) 445S(A) 446N 449Q(S) 455G 483S(E) 487A(N) 490S(A) (identity: 38.9 %/34.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5mfj_B_1 identity=34.9%
queryA       253:LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQ: 352
                :**  *  *   *   *       *    * ** *      *    *****          *  ** **  *  ** *  * ****     **        :
5mfj_B_1       6:LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVKLLDDASEEVIXEAVWAIANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVI: 105
SecStr          :HHHHHHHTT S HHHHHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHGGG S TTT - HHHHHHHHTTS HHHHHHHHHTT HHHHHHHHHHS HHHH:    
ExpBur          :beebbebbebeeeeebbebbeebbebbeeeeeebeebbeeebbeebbebbeeeeeebb-ebbebbbbbbebeeebbeebbeeebbeebbebbeeeeeebb:    

queryA       353:KEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAE: 452
                : ** *   **  *   ***     *    **  *  *      *****  *  **   ***  *   *   **  **       *     ** **     :
5mfj_B_1     106:QEAVWAIANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIQEAVWAIANIASGNN-EQIQKLIEAGALSPLVKLLDDASEEVIQEAVWAIANIAS---: 201
SecStr          :HHHHHHHHHHHTS HHHHHHHHHTT HHHHHHTTTSS HHHHHHHHHHHHHHHTS H-HHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHT---:    
ExpBur          :bebbebbbbbbebeeebbeebbeeebbeebbebbeeeeeebbebbbebbbbbbebee-ebbeebbeeebbebbbebbebeeeebbeebbebbbbbbe---:    
Contact         :            bbb  b                                   bbbb   b                         b  b  bb  b   


Input Residue Numbers for Focused Sites

ex) 2,15,123