Protein Model on 5mfe_A_1_N_1 (TEMPLATE: 5mfe )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:4]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [281 aa] YIIIM5AII
2 b N 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL 347P 348K(N) 349T(E) (identity: 33.3 %/39.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5mfe_A_1 identity=39.9%
queryA       121:IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS: 220
                : *  *  *   *    *      *  ****  **  ** * ** **   ** **   *   * *** ***  *      **  **   *  **  *    :
5mfe_A_1       6:LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-: 103
SecStr          :HHHHHHGGG S HHHHH-HHHHHHHHHHTS HHHHHHHHHTTHHHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S HH-:    
ExpBur          :beebbeebebeeeeebb-ebbeebbebbeeeeeebeebbeeebbebbbebbeeeeeebbeebbebbbbbbebeeebbebbbeeebbebbbebbeeeeee-:    

queryA       221:LACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIG: 318
                :     *    * ***     *      ***    ** ** **       *    ** *    * ** *  *   *  * ** **      *   ** *  :
5mfe_A_1     104:----ILQEALWALSNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALS: 197
SecStr          :----HHHHHHHHHHHHTTS HHHHHHHHHTT--HHHHHHHHTT S HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHH:    
ExpBur          :----bbbbbbebbbbbbebeeebbbebbeee--bbeebbebbeeeeeebbeebbebbbbbbebeeebbebbbeeebbeebbebbeeeeeebbebbbebbb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123