Protein Model on 4v3o_C_1_O_1 (TEMPLATE: 4v3o )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:3]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) C 1 (C) polymer(polypeptide(L)) [288 aa] YIII_M5_AII
2 b O 1 (C) non-polymer(CA) CALCIUM ION 305S(P) 307L(E) (identity: 0.0 %/39.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4v3o_C_1 identity=39.8%
queryA       121:IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS: 220
                : *  *  *   *    *      *  ****  **  ** * ** **   ** **   *   * * *****  *      **  **   *  **  *    :
4v3o_C_1      10:LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-: 107
SecStr          :HHHHHHGGG S HHHHH-HHHHHHHHHHTS HHHHHHHHHTTHHHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT S HH-:    
ExpBur          :beebbebbebeeeeebb-ebbeebbebbeeeeeebeebbebebbeebbebbeeeeeebbebbbebbbbbbeebeebbbbbbeeebbeebbebbebeeee-:    

queryA       221:LACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIG: 318
                :     *    *** *     *      ***    ** ** **       *    *       * ** *  *   *  * ** **      *   **   *:
4v3o_C_1     108:----ILQEALWTLGNIASGGNEQIQAVIDAG--ALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLG: 201
SecStr          :----HHHHHHHHHHHHTTS HHHHHHHHHTT--HHHHHHHHTT S HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHH:    
ExpBur          :----bbeebbebbbbbbebeeebbebbbeee--bbeebbebbebeeeebbebbbebbbbbbebeeebbbebbeeebbeebbebbeeeeeebbeebbebbb:    
Contact         :                                                                                      b b           


Input Residue Numbers for Focused Sites

ex) 2,15,123