Protein Model on 1wa5_B_1_C_1 (TEMPLATE: 1wa5 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (B) polymer(polypeptide(L)) [466 aa] SRP1 isoform 1 :A0A6A5Q590_YEASX
2 b C 1 (C) polymer(polypeptide(L)) [950 aa] Importin alpha re-exporter :CSE1_YEAST 34V(Q) 35N(Q) 36V 37E 38L 39R 40K 42K 387S(E) 388K(V) 390D(E) 391F(Y) 406S 409T(L) 410V(Q) 423E(K) 427N(D) 430T(E) 431A(I) 432K(A) 433D 434T(N) 435K(R) 438L(E) 457T(A) 459K(G) 460L 461S(N) 462I 465E 466E(K) 468G 471D(E) 480E 481N 483S(K) 500E 501E(D) (identity: 39.5 %/46.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1wa5_B_1 identity=46.9%
queryA        26:EMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVN------WSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAG: 119
                :* ****    ******* *    ****                                       **     ** **   *  **    ****  * **:
1wa5_B_1      31:ELRRRRDTQQVELRKAKRDEALAKRRNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXQELPQMTQQLNSDDMQEQLSATVKFRQILSQXXRPPIDVVIQAG: 130
SecStr          :     TTS     S     S  S     ----------------------------  HHHHHHHHHSS HHHHHHHHHHHHHHH  --   HHHHHHTT:    
ExpBur          :eebeebeeeeeeeeeeeeebbeebeebe----------------------------eeeeebbebbeeeeeeebbebbebbeeebbe--ebebeebeebe:    
Contact         :        bbbbbbb b                                                                                   

queryA       120:LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMS: 219
                :  *  * *         * * ************ *** ***  * * ** **        *** ***** ***    ** *    *  * * *       :
1wa5_B_1     131:VVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLF-----N: 225
SecStr          : HHHHHHTTSTTS HHHHHHHHHHHHHHTTS HHHHHHHHHTT HHHHHHHHHHS HHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHGG-----G:    
ExpBur          :bbeebbebbeeeeeeebbbbbbbbbbbbbbbeeebbeebbebebbebbbebbeebeeebebbbbbbbbbbbebeeebbbebbebebbebbeebb-----e:    

queryA       220:SLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGN: 319
                :*      *  ********* * * *    * * ****  *    * * * * ******* *** * *  *        ** **        ****** **:
1wa5_B_1     226:SNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGN: 325
SecStr          :   HHHHHHHHHHHHHHH  SSS   HHHHGGGHHHHHHHTT   HHHHHHHHHHHHHHTSSSHHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHH:    
ExpBur          :eeeeebbebbbbbbbbbbeeeeeebeeeebbebbebbbebbeeebeebbbbbbbbbbbbbbbeeebbebbbeeebbebbbebbebebeebbbbbbbbbbb:    

queryA       320:IVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLV: 417
                :**** * ****** ** *     **  ** ** *** ** ******   *** *    * * **  *  *  ** *** **  *  ***      * ***:
1wa5_B_1     326:IVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLV: 425
SecStr          :HTTS HHHHHHHHHTTHHHHHHHHTT SSHHHHHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHHHHHS HHHHHHHHHHHHHHHHHTTTSHHHHHHHH:    
ExpBur          :bbbbeeebbeebbeeebbebbeebbebeeeebbbbbbbbbbbbbbbebebbebbbebebbeebbebbeebeeebbebbbbbbbbbbebbeeeeebbeebb:    
Contact         :                                                                   bb bb              b  bb         

queryA       418:HCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEE: 501
                :  * * **  **   *  ** * ***  **    *   *   * *      **  **  **   *  **   *      ** **  ** :
1wa5_B_1     426:SQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIETYFGEEED: 514
SecStr          :HTT HHHHHHHTTT  HHHHHHHHHHHHHHHHHHHHHHHHHT SS HHHHHHHHTTHHHHHHHGGG S HHHHHHHHHHHHHHSS    :    
ExpBur          :eeebbebbbebbeebeeebbbbbbebbbbbbebbeebbeeeeeeebebbeebeebebeebbeebbeeeeeebeeebeebbeebbeeeee:    
Contact         :     b   b  bbbbbb  b                  b bbbb b  b  bb b  b        bb b                bb           


Input Residue Numbers for Focused Sites

ex) 2,15,123