Protein Model on 1wa5_B_1_A_1 (TEMPLATE: 1wa5 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (B) polymer(polypeptide(L)) [466 aa] SRP1 isoform 1 :A0A6A5Q590_YEASX
2 b A 1 (A) polymer(polypeptide(L)) [170 aa] GTP-binding nuclear protein Ran :RAN_CANLF 474E(F) 477Q 478N(Q) 479H(N) 485Y 489L(Y) 493E (identity: 42.9 %/46.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1wa5_B_1 identity=46.9%
queryA        26:EMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVN------WSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAG: 119
                :* ****    ******* *    ****                                       **     ** **   *  **    ****  * **:
1wa5_B_1      31:ELRRRRDTQQVELRKAKRDEALAKRRNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXQELPQMTQQLNSDDMQEQLSATVKFRQILSQXXRPPIDVVIQAG: 130
SecStr          :     TTS     S     S  S     ----------------------------  HHHHHHHHHSS HHHHHHHHHHHHHHH  --   HHHHHHTT:    
ExpBur          :eebeebeeeeeeeeeeeeebbeebeebe----------------------------eeeeebbebbeeeeeeebbebbebbeeebbe--ebebeebeebe:    

queryA       120:LIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMS: 219
                :  *  * *         * * ************ *** ***  * * ** **        *** ***** ***    ** *    *  * * *       :
1wa5_B_1     131:VVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLF-----N: 225
SecStr          : HHHHHHTTSTTS HHHHHHHHHHHHHHTTS HHHHHHHHHTT HHHHHHHHHHS HHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHGG-----G:    
ExpBur          :bbeebbebbeeeeeeebbbbbbbbbbbbbbbeeebbeebbebebbebbbebbeebeeebebbbbbbbbbbbebeeebbbebbebebbebbeebb-----e:    

queryA       220:SLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGN: 319
                :*      *  ********* * * *    * * ****  *    * * * * ******* *** * *  *        ** **        ****** **:
1wa5_B_1     226:SNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGN: 325
SecStr          :   HHHHHHHHHHHHHHH  SSS   HHHHGGGHHHHHHHTT   HHHHHHHHHHHHHHTSSSHHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHH:    
ExpBur          :eeeeebbebbbbbbbbbbeeeeeebeeeebbebbebbbebbeeebeebbbbbbbbbbbbbbbeeebbebbbeeebbebbbebbebebeebbbbbbbbbbb:    

queryA       320:IVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTV--EQIVYLV: 417
                :**** * ****** ** *     **  ** ** *** ** ******   *** *    * * **  *  *  ** *** **  *  ***      * ***:
1wa5_B_1     326:IVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAISNASSGGLQRPDIIRYLV: 425
SecStr          :HTTS HHHHHHHHHTTHHHHHHHHTT SSHHHHHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHHHHHS HHHHHHHHHHHHHHHHHTTTSHHHHHHHH:    
ExpBur          :bbbbeeebbeebbeeebbebbeebbebeeeebbbbbbbbbbbbbbbebebbebbbebebbeebbebbeebeeebbebbbbbbbbbbebbeeeeebbeebb:    

queryA       418:HCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSI-----MIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEE: 501
                :  * * **  **   *  ** * ***  **    *   *   * *      **  **  **   *  **   *      ** **  ** :
1wa5_B_1     426:SQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIETYFGEEED: 514
SecStr          :HTT HHHHHHHTTT  HHHHHHHHHHHHHHHHHHHHHHHHHT SS HHHHHHHHTTHHHHHHHGGG S HHHHHHHHHHHHHHSS    :    
ExpBur          :eeebbebbbebbeebeeebbbbbbebbbbbbebbeebbeeeeeeebebbeebeebebeebbeebbeeeeeebeeebeebbeebbeeeee:    
Contact         :                                                             b  bbb     b   b   b                   


Input Residue Numbers for Focused Sites

ex) 2,15,123