#WARNING:no index is registered index "YP_009725301.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725301.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.
CurrentView:HTML5 Change to:[JAVA] |
DOWNLOAD: [sequence-replaced 3D model] [for PyMOL] [3D template] [Modeller script]
|
MOLECULES | contact sites | |||||
model | mark | query | asym_id oper (auth_asym_id) |
type | description | a(query A) |
1 | a | A(queryA) | A 1 (A) | polymer(polypeptide(L)) [306 aa] | 3C-like proteinase nsp5 :R1AB_SARS2 | |
2 | b | A 2 (A) | polymer(polypeptide(L)) [306 aa] | 3C-like proteinase nsp5 :R1AB_SARS2 | 1S 2G 3F 4R 5K 6M 7A 8F 9P 10S 11G 14E 118Y 121S 122P 123S 124G 125V 126Y 127Q 137K 138G 139S 140F 141L 166E 172H 283G 285A 286L 290E 299Q 300C 301S 302G 303V 304T 305F (identity: 100.0 %/99.7 %) | |
3 | c | B 1 (A) | non-polymer(DMS) | DIMETHYL SULFOXIDE | 74Q 75L 76R (identity: 100.0 %/99.7 %) | |
4 | d | B 2 (A) | non-polymer(DMS) | DIMETHYL SULFOXIDE | ||
5 | e | C 1 (A) | non-polymer(DMS) | DIMETHYL SULFOXIDE | 6M 7A 8F 127Q 295D 298R (identity: 100.0 %/99.7 %) | |
6 | f | C 2 (A) | non-polymer(DMS) | DIMETHYL SULFOXIDE | 123S (identity: 100.0 %/99.7 %) | |
7 | g | D 1 (A) | non-polymer(DMS) | DIMETHYL SULFOXIDE | 5K 125V 126Y 127Q (identity: 100.0 %/99.7 %) | |
8 | h | D 2 (A) | non-polymer(DMS) | DIMETHYL SULFOXIDE | 5K 7A 125V 126Y 127Q (identity: 100.0 %/99.7 %) | |
9 | i | E 1 (A) | non-polymer(GOL) | GLYCEROL | 17M 19Q 69Q 71G 119N 120G 121S (identity: 100.0 %/99.7 %) | |
10 | j | E 2 (A) | non-polymer(GOL) | GLYCEROL |
ALIGNMENTS |
MODEL[1] Protein A "queryA" TEMPLATE:7zb7_A_1 identity=99.7% |
queryA 1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100 :***************************************************** **********************************************: 7zb7_A_1 1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNFEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK: 100 SecStr : HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG TTGGGS HHHHHHT GGGEEEEETTEEE EEEEEEETTEEEEEESS TT E: ExpBur :eebeeeebebeebeebbbebbbeeeebbbbbbeeebbbbebbbbeeeebeebebeeebeeeeeeebebebeeeebebeeeeeeebbbebebeeebeeebe: Contact :bbbbbbbbbbb b i i i i ccc Contact : geee Contact : h h queryA 101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200 :****************************************************************************************************: 7zb7_A_1 101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI: 200 SecStr :EEE TT EEEEEEEETTEEEEEEEEE TTS B TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT SSSS B : ExpBur :eeeeebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeebbbbbbbbbbeeebbbbbbbbbbebeeeebbbbbbebebbeebebeeeebebeeebeb: Contact : biibbbbbbb bbbbb b b Contact : i f gge Contact : hhg Contact : h queryA 201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300 :****************************************************************************************************: 7zb7_A_1 201:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC: 300 SecStr :HHHHHHHHHHHHHTT TT S HHHHHHHHHHTTB HHHHHHTHHHHHHHT HHHHHHHHHHHHHHTTTT BTTBSS HHHHHHHH: ExpBur :bbbbbbbbbbbbebeeeebeeeeebeeeebbebbeeeebeebeeeebeebeebbeebebebeebbbbbbbbbeeebeeeebeebeebebbbbbebbeeee: Contact : b bb b e ebb queryA 301:SGVTFQ: 306 :******: 7zb7_A_1 301:SGVTFQ: 306 SecStr :HT : ExpBur :eeeebe: Contact :bbbbb |