Protein Model on 5i81 assembly_id=2 (TEMPLATE: 5i81 assembly_id:2 )

CurrentView:HTML5 Change to:[JAVA] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(ASM_HUMAN) A 1 (A) polymer(polypeptide(L)) [528 aa] Sphingomyelin phosphodiesterase :ASM_HUMAN
2 b A 2 (A) polymer(polypeptide(L)) [528 aa] Sphingomyelin phosphodiesterase :ASM_HUMAN 86W 88N 89L 92P 93I 95K 96G 97L 98F 99T 100A 101I 105L 114V 117V 118A 121L 122C 127I 136I 137V 148W 152V 153L 162L 226P 286V 327N (identity: 100.0 %/100.0 %)
3 c B 1 (B) branched(oligosaccharide) 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose 139L 289Q 290T 291R 337N (identity: 100.0 %/100.0 %)
4 d B 2 (B) branched(oligosaccharide) 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
5 e C 1 (C) branched(oligosaccharide) beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose 171D 397N 399T (identity: 100.0 %/100.0 %)
6 f C 2 (C) branched(oligosaccharide) beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
7 g D 1 (D) branched(oligosaccharide) beta-D-mannopyranose-(1-3)-alpha-D-mannopyranose 177N 178I 179S (identity: 100.0 %/100.0 %)
8 h D 2 (D) branched(oligosaccharide) beta-D-mannopyranose-(1-3)-alpha-D-mannopyranose
9 i E 1 (A) non-polymer(NAG) 2-acetamido-2-deoxy-beta-D-glucopyranose 88N (identity: 100.0 %/100.0 %)
10 j E 2 (A) non-polymer(NAG) 2-acetamido-2-deoxy-beta-D-glucopyranose 126K 127I (identity: 100.0 %/100.0 %)
11 k F 1 (A) non-polymer(NAG) 2-acetamido-2-deoxy-beta-D-glucopyranose 175S 176W 177N (identity: 100.0 %/100.0 %)
12 l F 2 (A) non-polymer(NAG) 2-acetamido-2-deoxy-beta-D-glucopyranose
13 m G 1 (A) non-polymer(BMA) beta-D-mannopyranose
14 n G 2 (A) non-polymer(BMA) beta-D-mannopyranose
15 o H 1 (A) non-polymer(NAG) 2-acetamido-2-deoxy-beta-D-glucopyranose 374Y 505N (identity: 100.0 %/100.0 %)
16 p H 2 (A) non-polymer(NAG) 2-acetamido-2-deoxy-beta-D-glucopyranose
17 q I 1 (A) non-polymer(NAG) 2-acetamido-2-deoxy-beta-D-glucopyranose
18 r I 2 (A) non-polymer(NAG) 2-acetamido-2-deoxy-beta-D-glucopyranose
19 s J 1 (A) non-polymer(NAG) 2-acetamido-2-deoxy-beta-D-glucopyranose 522N 524T 525Q 536Q 574F 579G (identity: 100.0 %/100.0 %)
20 t J 2 (A) non-polymer(NAG) 2-acetamido-2-deoxy-beta-D-glucopyranose
21 u K 1 (A) non-polymer(NAG) 2-acetamido-2-deoxy-beta-D-glucopyranose
22 v K 2 (A) non-polymer(NAG) 2-acetamido-2-deoxy-beta-D-glucopyranose
23 w L 1 (A) non-polymer(ZN) ZINC ION 208D 280D 320N 427H 459H (identity: 100.0 %/100.0 %)
24 x L 2 (A) non-polymer(ZN) ZINC ION
25 y M 1 (A) non-polymer(ZN) ZINC ION 208D 210H 280D 461H (identity: 100.0 %/100.0 %)
26 z M 2 (A) non-polymer(ZN) ZINC ION
27 1 N 1 (A) non-polymer(SO4) SULFATE ION 432H 459H (identity: 100.0 %/100.0 %)
28 2 N 2 (A) non-polymer(SO4) SULFATE ION
29 3 O 1 (A) non-polymer(SO4) SULFATE ION 107K 110N (identity: 100.0 %/100.0 %)
30 4 O 2 (A) non-polymer(SO4) SULFATE ION 107K 110N (identity: 100.0 %/100.0 %)
31 5 P 1 (A) non-polymer(SO4) SULFATE ION 134Q 135S 138H (identity: 100.0 %/100.0 %)
32 6 P 2 (A) non-polymer(SO4) SULFATE ION
33 7 Q 1 (A) non-polymer(SO4) SULFATE ION 189K 192S (identity: 100.0 %/100.0 %)
34 8 Q 2 (A) non-polymer(SO4) SULFATE ION
35 9 R 1 (A) non-polymer(SO4) SULFATE ION 150R 333F 334I 335E 338H (identity: 100.0 %/100.0 %)
36 A R 2 (A) non-polymer(SO4) SULFATE ION
37 B S 1 (A) non-polymer(SO4) SULFATE ION 174S 175S (identity: 100.0 %/100.0 %)
38 C S 2 (A) non-polymer(SO4) SULFATE ION
39 D T 1 (A) non-polymer(SO4) SULFATE ION 585P 586C 587G 588T 589P 590C (identity: 100.0 %/100.0 %)
40 E T 2 (A) non-polymer(SO4) SULFATE ION
41 F U 1 (A) non-polymer(SO4) SULFATE ION 582P 583S 584E (identity: 100.0 %/100.0 %)
42 G U 2 (A) non-polymer(SO4) SULFATE ION
43 H V 1 (A) non-polymer(SO4) SULFATE ION 460T 490Y 491I (identity: 100.0 %/100.0 %)
44 I V 2 (A) non-polymer(SO4) SULFATE ION
45 J W 1 (A) non-polymer(SO4) SULFATE ION 564G 565D 566M 567Q (identity: 100.0 %/100.0 %)
46 K W 2 (A) non-polymer(SO4) SULFATE ION
47 L X 1 (A) non-polymer(SO4) SULFATE ION 563R 564G (identity: 100.0 %/100.0 %)
48 M X 2 (A) non-polymer(SO4) SULFATE ION
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5i81_A_1 identity=100.0%
queryA        86:WGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPK: 185
                :****************************************************************************************************:
5i81_A_1      38:WGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPK: 137
SecStr          : GGGHHHHHHHHHHHHHHHHTSHHHHHHHHHHHHHHHHHTTSS HHHHHHHHHHHHHHHHHHHHHTTTSHHHHHHHHH TTT    TT        SS  :    
ExpBur          :eeeeeeeebeeebeeebeebeeeeebeeebeeebeebeeeeebeeebbeeebeebbebebbbebebbeeeebbbbeeeeeebbeeebeeebebeeeeeee:    
Contact         :b bb  bb bbbbbbb   b 3  3   b  bb  bb   jb      55bb5c        b 9 bb        b        e  Bkkggg      
Contact         :  i                  4  4                j                                               B k        

queryA       186:PPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHD: 285
                :****************************************************************************************************:
5i81_A_1     138:PPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHD: 237
SecStr          :          TT  EEEEEEE    B TTB TTS TT SSSS SBTTS    TTS    SS  SSS  B HHHHHHHHHT GGG   SEEEE S  B S :    
ExpBur          :eeeeeeeeeeeeeeebebbbbbbbbbbeebeeebbbebebebbbbeebeeeeeeeeebbebbbebebbbbeebbebbbeebeebeebebbbbbbbbbbbb:    
Contact         :   7  7               w y               b                                                     w     
Contact         :                      y                                                                       y     

queryA       286:VWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMN: 385
                :****************************************************************************************************:
5i81_A_1     238:VWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMN: 337
SecStr          :TTS  HHHHHHHHHHHHHHHHHHHTTS EEE   TTSSSSTT    TT  STTSSHHHHHHHHHHSTTTS HHHHHHHHHHS EEEEEETTEEEEE  GG:    
ExpBur          :bbebeeeebeebbeebbebbeeebeeeebbbbbbbbbbbbbbbbbbeebeeeebbebbbebbbebbeebbeeebbeebeebbbbbbebbeebbbbbbbbb:    
Contact         :b  ccc                            w      b     999 c9                                   o           

queryA       386:FCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAP: 485
                :****************************************************************************************************:
5i81_A_1     338:FCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAP: 437
SecStr          :GG TT GGGGT  SSGGGHHHHHHHHHHHHHHHT EEEEE SS GGGS HHHHHHHHHHHHHTTTTEEEEEE SS S EEEEEE TTTS SEEEEEEE  :    
ExpBur          :bbbeebbbbbbebebbeebbeebbebbbebbeeebebbbbbbbbbbebbebbbebbbebbbbbbbbbbbbbbbeebbbbbbbbbbeeebeebbbbbbbbb:    
Contact         :           e e                           w    1                          wHy                        
Contact         :                                                                         1                          

queryA       486:SATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEP: 585
                :****************************************************************************************************:
5i81_A_1     438:SATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEP: 537
SecStr          : SS TTT   EEEEEEEE SSTT    EEEEEEEEE HHHHTSTT    EEEEEEHHHHHT S  SHHHHHHHHHHHHT HHHHHHHHHHHTTT   SS :    
ExpBur          :bbbbeeebbbbbbbbbbbbeeeebbbbbebbbbbbbebeebeeeeeebebeebbebeeebebeebebebbeebbeebeeeeebbeebbebbbbbeeeeee:    
Contact         :    HH             o                s ss          s                          LJJJJ      s    s  FFFD
Contact         :                                                                              L                     

queryA       586:CGTPCRLATLCAQLSARADSPALCRHLM: 613
                :****************************:
5i81_A_1     538:CGTPCRLATLCAQLSARADSPALCRHLM: 565
SecStr          :  HHHHHHHHHHHH  STT GGGGTTT :    
ExpBur          :beeeebbebbbebbebbbebeebbeebe:    
Contact         :DDDDD                                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123