Protein Model on 5jg8 assembly_id=1 (TEMPLATE: 5jg8 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description b(query A)
1 a A 1 (A) polymer(polypeptide(L)) [529 aa] Sphingomyelin phosphodiesterase :ASM_HUMAN 84F 86W 89L 92P 93I 94C 95K 96G 97L 98F 100A 101I 114V 117V 118A 121L 136I 140F 144M 145V 148W 152V 153L 161L 162L (identity: 100.0 %/100.0 %)
2 b A(ASM_HUMAN) B 1 (B) polymer(polypeptide(L)) [530 aa] Sphingomyelin phosphodiesterase :ASM_HUMAN
3 c C 1 (C) branched(oligosaccharide) 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
4 d D 1 (D) branched(oligosaccharide) 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
5 e E 1 (E) branched(oligosaccharide) 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-3)-2-acetamido-2-deoxy-beta-D-glucopyranose
6 f F 1 (F) branched(oligosaccharide) alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose 522N 524T 525Q 536Q 574F 579G (identity: 100.0 %/100.0 %)
7 g G 1 (G) branched(oligosaccharide) alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose 139L 289Q 290T 291R 337N (identity: 100.0 %/100.0 %)
8 h H 1 (H) branched(oligosaccharide) 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose 171D 397N (identity: 100.0 %/100.0 %)
9 i I 1 (I) branched(oligosaccharide) 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose 373P 374Y 505N (identity: 100.0 %/100.0 %)
10 j J 1 (A) non-polymer(ZN) ZINC ION
11 k K 1 (A) non-polymer(ZN) ZINC ION
12 l L 1 (A) non-polymer(ACT) ACETATE ION
13 m M 1 (A) non-polymer(NAG) 2-acetamido-2-deoxy-beta-D-glucopyranose 127I (identity: 100.0 %/100.0 %)
14 n N 1 (A) non-polymer(NAG) 2-acetamido-2-deoxy-beta-D-glucopyranose
15 o O 1 (A) non-polymer(NAG) 2-acetamido-2-deoxy-beta-D-glucopyranose
16 p P 1 (B) non-polymer(ZN) ZINC ION 208D 210H 280D 461H (identity: 100.0 %/100.0 %)
17 q Q 1 (B) non-polymer(ZN) ZINC ION 208D 280D 320N 427H 459H (identity: 100.0 %/100.0 %)
18 r R 1 (B) non-polymer(ACT) ACETATE ION 208D 210H 280D 284H 320N 321H 427H 459H 461H (identity: 100.0 %/100.0 %)
19 s S 1 (B) non-polymer(NAG) 2-acetamido-2-deoxy-beta-D-glucopyranose 84F 88N (identity: 100.0 %/100.0 %)
20 t T 1 (B) non-polymer(NAG) 2-acetamido-2-deoxy-beta-D-glucopyranose 176W 177N (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[2] Protein A "queryA" TEMPLATE:5jg8_B_1 identity=100.0%
queryA        84:FGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTV: 183
                :****************************************************************************************************:
5jg8_B_1      39:FGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTV: 138
SecStr          :  GGGTHHHHHHHHHHHHHHHHTSHHHHHHHHHHHHHHHHHH  S HHHHHHHHHHHHHHHHHHHHHTTSSTTTHHHHHTBTTB    TT        SS:    
ExpBur          :eeeeeeeeeebeeebeeebeebeeeeebeeebeeebeeeeeeeebeeebbeeebeebbebebebebebbeeebbbbbeeebeebbeeebeeebebeeeee:    
Contact         :a a sa  aaaaaaa aa            a  aa  a     m        a  ga   aa  a   aa       aa        h    tt      
Contact         :s                                                                                                   

queryA       184:PKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPA: 283
                :****************************************************************************************************:
5jg8_B_1     139:PKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPA: 238
SecStr          :            TT  EEEEEEE    B S B TTS SS SSSS SBTTS    TT     TT  SSS  B HHHHHHHHHTTSSS   SEEEE    B :    
ExpBur          :eeeeeeeeeeeeeeeeebbbbbbbbbbbbeebeeebbbebeeebbbbeebeeeeeeeeebbebbbbeebbbbeebbebbbeebeeebebebbbbbbbbbb:    
Contact         :                        p p                                                                     p   
Contact         :                        q r                                                                     q   
Contact         :                        r                                                                       r   

queryA       284:HDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLN: 383
                :****************************************************************************************************:
5jg8_B_1     239:HDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLN: 338
SecStr          :S  SS  HHHHHHHHHHHHHHHHHHHTTS EEE   SSSSSSTT    TTS SSSSSHHHHHHTTTSSTTTS HHHHHHHHHTS EEE SSTTEEEEE  :    
ExpBur          :bbbbebeeeebeebbeebbebbeeebeeeebbbbbbbbbbbbbbbbbbeebeeeebbebbbebbbebbeebbeeebbebbeebbbbbbebbeebbbbbbb:    
Contact         :r    ggg                            qr               g                                   ii         
Contact         :                                    r                                                               

queryA       384:MNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFL: 483
                :****************************************************************************************************:
5jg8_B_1     339:MNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFL: 438
SecStr          :GGGG SS GGGGT  SSGGGHHHHHHHHHHHHHHHT EEEEEESS TTSS SHHHHHHHHHHHHTTTTEEEEEEEEEES EEEEEE TTTS SEEEEEEE:    
ExpBur          :bbbbbeebbbbbbebebbeebbeebbebbbebbeeebebbbbbbbbbeebbebbbebbbebbbbbbebbbbbbbbbbbbbbbbbbbbeeebeebbbbbbb:    
Contact         :             h                             q                               q p                      
Contact         :                                           r                               r r                      

queryA       484:APSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPS: 583
                :****************************************************************************************************:
5jg8_B_1     439:APSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPS: 538
SecStr          :EE SS TTT   EEEEEEEE SSTT    EEEEEEEEE HHHHTSTT    EE   BHHHHHT S SSHHHHHHHHHHHHH HHHHHHHHHHHTTT   S:    
ExpBur          :bbbbbbeeebbbbbbbbbbbbeeeebbbbbbbbbbbbbebeebeeeeeeeebeeebebeeebebeebebebbbebbeebeeeeebbeebbebbbbeeeee:    
Contact         :                     i                f ff          f                                     f    f    

queryA       584:EPCGTPCRLATLCAQLSARADSPALCRHLM: 613
                :******************************:
5jg8_B_1     539:EPCGTPCRLATLCAQLSARADSPALCRHLM: 568
SecStr          :S   HHHHHHHHHHHH  STT GGGGGGG :    
ExpBur          :eebeeeebeebbeebbbbbbebeebbeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123