Protein Model on 5fc1 assembly_id=1 (TEMPLATE: 5fc1 assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(ASM_HUMAN) A 1 (A) polymer(polypeptide(L)) [426 aa] Acid sphingomyelinase-like phosphodiesterase 3a :ASM3A_MOUSE
2 b B 1 (B) branched(oligosaccharide) 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose 232G 234G(N) (identity: 50.0 %/35.1 %)
3 c C 1 (C) branched(oligosaccharide) 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose 256L(Y) 300T(N) 303A(M) (identity: 0.0 %/35.1 %)
4 d D 1 (D) branched(oligosaccharide) alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose 520I(Y) 522N 524T 525Q(E) 579G(S) (identity: 40.0 %/35.1 %)
5 e E 1 (E) branched(oligosaccharide) 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose 413Q(N) 417D(W) (identity: 0.0 %/35.1 %)
6 f F 1 (A) non-polymer(ZN) ZINC ION 208D 210H 280D 461H (identity: 100.0 %/35.1 %)
7 g G 1 (A) non-polymer(ZN) ZINC ION 280D 320N 427H 459H (identity: 100.0 %/35.1 %)
8 h H 1 (A) non-polymer(NAG) 2-acetamido-2-deoxy-beta-D-glucopyranose 534H(N) 536Q(T) (identity: 0.0 %/35.1 %)
9 i I 1 (A) non-polymer(SO4) SULFATE ION 210H 280D 284H 320N 321H 459H 461H (identity: 100.0 %/35.1 %)
10 j J 1 (A) non-polymer(GOL) GLYCEROL 204L(W) 266L(I) 267G(K) 272F(A) 309L(F) (identity: 0.0 %/35.1 %)
11 k K 1 (A) non-polymer(GOL) GLYCEROL
12 l L 1 (A) non-polymer(GOL) GLYCEROL 229C(S) 231R(K) 284H 490Y(V) 491I(K) 492G (identity: 33.3 %/35.1 %)
13 m M 1 (A) non-polymer(GOL) GLYCEROL 290T(S) 291R(T) 292Q(G) (identity: 0.0 %/35.1 %)
14 n N 1 (A) non-polymer(GOL) GLYCEROL 284H 459H 460T 461H 462V(R) 490Y(V) (identity: 66.7 %/35.1 %)
15 o O 1 (A) non-polymer(GOL) GLYCEROL 239S 250S(V) 251K(L) 491I(K) 493L(V) 580H(Y) (identity: 16.7 %/35.1 %)
16 p P 1 (A) non-polymer(GOL) GLYCEROL 560Y(Q) (identity: 0.0 %/35.1 %)
17 q Q 1 (A) non-polymer(GOL) GLYCEROL 501Q 517E(V) 543E(Q) (identity: 33.3 %/35.1 %)
18 r R 1 (A) non-polymer(GOL) GLYCEROL 362T 403G(N) 406Q(E) 407W (identity: 50.0 %/35.1 %)
19 s S 1 (A) non-polymer(GOL) GLYCEROL 200V 201S(G) 373P(S) 374Y(N) 506Y 508G(P) (identity: 33.3 %/35.1 %)
20 t T 1 (A) non-polymer(GOL) GLYCEROL 525Q(E) 529P(K) (identity: 0.0 %/35.1 %)
21 u U 1 (A) non-polymer(GOL) GLYCEROL 323S(Y) 340S(T) 341R(S) 342W(K) (identity: 0.0 %/35.1 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5fc1_A_1 identity=35.1%
queryA       191:PSPPAPGAP-VSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLGPAG-PFDMVYWTGDIPAHD-VW: 287
                :*  **  ** *      **** *  *   ** *         *     ** **    *    ** *     *        *       **** * *  * :
5fc1_A_1      12:PLAPADRAPAVGQFWHVTDLHLDPTY-HITD-DRTKVCASSKGAN---ASNPGP--FGD-VLCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVP: 103
SecStr          :     SS    EEEEEE    B TT -   S-SGGGS GGGTT  --- SS BT--TB -TTS B HHHHHHHHHHHHHS    SEEEE    S S  GG:    
ExpBur          :eeeeeeeeeeebbbbbbbbbbbbeeb-eeee-eeeebbebbeebe---beebbe--bbb-bbbbbbeebbebbbebbeeeeeebbbbbbbbbbbbbbeee:    
Contact         :         sss  j   f f                  l lb b    o          oo    c         jj   j j       f   i    
Contact         :                    i                                                            q         g   l    
Contact         :                                                                                           i   n    

queryA       288:HQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYA--LSPYPGLRLISLNMN: 385
                :           *  *  *        * ** ***   *    *             * * *  * ***  **  **  ****       **** **** *:
5fc1_A_1     104:ELSTGTVIKVITNMTMTVQNLFPNLQVFPALGNHDYWPQDQLPI-------VTSKVYSAVADLWKPWLGEEAISTLKKGGFYSQKVASNPGLRIISLNTN: 196
SecStr          :G  HHHHHHHHHHHHHHHHHH TT EEEE   TTSSSSTT   S-------S  HHHHHHHHHHTTTS HHHHHHHHHHS EEEE TTSTTEEEEE  GG:    
ExpBur          :ebeeeebeebbeebbebbbeebeebbbbbbbbbbbbeeebbbbe-------eebebbebbbebbeebbeeebbebbeebbbbbbebeebeebbbbbbbbb:    
Contact         :  mmm       c  c     j          gi u                uuu                   r            ss           
Contact         :                                i                                                                   

queryA       386:FCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGH---------CLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSR: 476
                :     *     * **** *  **   *        ** ** * * *                     *  **    * ** **** *   *  *      :
5fc1_A_1     197:LYYGPNI-MTLNKTDPANQFEWLENTLNSSLWNKEKVYIIAHVPVGYLPYATDTPAIRQYYNEKLLDIFRRYSSVIAGQFYGHTHRDSLMVLSDKN--GN: 293
SecStr          :GGSTT G-GGTT SSGGGHHHHHHHHHHHHHHTT EEEEEESS SSB TTSSS BSS HHHHHHHHHHHHHTTTTEEEEEE SS S EEEEEE TT--S :    
ExpBur          :bbbeebe-ebeeeebbbebbebbeebbeebeeeebebbbbbbbbbbbbbebeeebbbbeebbeebbebbeebbebbebbbbbbbbbbbbbbbbeee--ee:    
Contact         :                 r  rr     e   e         g                                        gnfn              
Contact         :                                                                                  i i               
Contact         :                                                                                  n n               

queryA       477:PLAVAFLAPSATTYIGL------NPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRM-RGDMQLF: 569
                :**   * **  *   *       *** *  *    *       **   * **** **  *    * * *     *      *     **      *   *:
5fc1_A_1     294:PLNSVFVAPAVTPVKGVLQKETNNPGVRLFQ----YKPGDYTLLDMVQYYLNLTEANLKGE-SNWTLEYVLTQAYSVADLQPKSLYALVQQFATKDSKQF: 388
SecStr          :EEEEEEE   S     TT S     EEEEEE----E TTT  EEEEEEEE  HHHHHHHT -   EEEEEHHHHHT S S HHHHHHHHHHHTSTT HHH:    
ExpBur          :bebbbbbbbbbbbbbeeeeebbbbbbbbbbe----beeeebebebbbbbbbebeebbeeee-eebeebbbbbebbebebbeeeebeebbeebeeeebebb:    
Contact         :             lllokkkk         q    s s        q  d d dd   t    h h      q                p          
Contact         :             no   l                                   t                                             
Contact         :                  n                                                                                 

queryA       570:QTFWFLYHKGHPPSEPCGTPCRLATLCA--QLSARADSPALCRHL: 612
                :      *      *  *   *     **   *        *  **:
5fc1_A_1     389:LKYYHYYFVSYDSSATCDQHCKTLQVCAIMNLDSMSYDDCLKQHL: 433
SecStr          :HHHHHHHTTTS TT    HHHHHHHHHHHH  SHHHHHHHHHHH :    
ExpBur          :eebbebbbbeebeebebeeebbbbbbbbbbbbbbebbeebbeeee:    
Contact         :         do                                                                                         


Input Residue Numbers for Focused Sites

ex) 2,15,123