#WARNING:no index is registered index "YP_009724389.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009724389.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein. [pdbjlvh2]Protein Model on 5rmk assembly_id=2

Protein Model on 5rmk assembly_id=2 (TEMPLATE: 5rmk assembly_id:2 )

CurrentView:HTML5 Change to:[JAVA] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [585 aa] Helicase :R1AB_SARS2
2 b H 1 (B) non-polymer(O2A) N-methyl-1H-indole-7-carboxamide 5876T 5877A 5880C (identity: 100.0 %/98.8 %)
3 c I 1 (B) non-polymer(ZN) ZINC ION 5340C 5343C 5357H 5363H (identity: 100.0 %/98.8 %)
4 d J 1 (B) non-polymer(ZN) ZINC ION 5329C 5332C 5350C 5353C (identity: 100.0 %/98.8 %)
5 e K 1 (B) non-polymer(ZN) ZINC ION 5374C 5376A 5379C 5396C 5399H (identity: 100.0 %/98.8 %)
6 f L 1 (B) non-polymer(PO4) PHOSPHATE ION 5609G 5610T 5611G 5612K 5613S 5767R (identity: 100.0 %/98.8 %)
7 g M 1 (B) non-polymer(PO4) PHOSPHATE ION 5607P 5608P 5609G 5612K 5728Q 5767R 5862G 5891R (identity: 100.0 %/98.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5rmk_B_1 identity=98.8%
queryA      5326:VGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGSD:5425
                :****************************************************************************************************:
5rmk_B_1       2:VGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGSD: 101
SecStr          : EE TTT  EES EESSSTT  B  HHHHHHHHTTSS   EESSSBS   STT     GGGEEEETTEEEETTT  SS EESEETTEE  TTTTS    S:    
ExpBur          :eeebbebebebbbebbebeeebebbbbbbeebbeebebeebbbeeebebebeebeeeebeebbbbeeebebeeeeeeebeebbeeeebebeebeebeeee:    
Contact         :   d  d       c  c      d  d   c     c          e e  e                e  e                          

queryA      5426:NVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTFE:5525
                :****************************************************************************************************:
5rmk_B_1     102:NVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTFE: 201
SecStr          :  HHHHHHHH  S BHHHHHHHHHS HHHHHHHHHHHHHHHHHHHHTS  EEEEEEEETTEEEEEE SSS     STTS EEEEEE SSSEEEEEEE EE:    
ExpBur          :ebeebbebbebebbebebbeebbebeeebbbbbbbbbebebbeeeeebbebebeeeeeebebebebeeeeeebebbeebebbbbbeeeeeeeebeebbbe:    

queryA      5526:KGDYGDAVVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYPS:5625
                :**    **********************************************************************************************:
5rmk_B_1     202:KGXXXXAVVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYPS: 301
SecStr          :E ---- EEE  BS     TT EEEE         S SS    B SS  S    SS  TTSGGGHHHHHHHHTBSEEEEE  TTS HHHHHHHHHHHSTT:    
ExpBur          :ee----ebebeeeeeeebeeebbbebbeeebeebebebbbeeeeeeeeeebeeeeeeeeebeebeeebeebbebebbbbbbbbebebebbbbbbbebbee:    
Contact         :                                                                                 ggfffff            
Contact         :                                                                                   g  g             

queryA      5626:ARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYIGD:5725
                :***********************************   **************************************************************:
5rmk_B_1     302:ARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPAXXXVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYIGD: 401
SecStr          :  EEEEESSHHHHHHHHHHHHHHS GGGEEE    ---     SSEET TTSSEEEEEGGG  SEEEEEEEE  GGG  HHHHHHHHHHEEEEEEEEEE :    
ExpBur          :bbbbbbbeeeebbbebbeebeebbeeeebbbbeee---eebbeebeeeeeebbbbbbbbebbbebebebbbbbebbebebbbbbbbbeebebebbbbbbb:    

queryA      5726:PAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLT:5825
                :****************************************************************************************************:
5rmk_B_1     402:PAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLT: 501
SecStr          :TTS     TT  BS   GGGS HHHHHHHHT  SEE  EESSS HHHHHHHHHHHSTT  EESS   S EEEEE     EE SS EE HHHHHHHHHHHH:    
ExpBur          :bbbbbbebebbeeeebebebbbbbbeebeeeeeebebeebebbbbbbbebbbebbbeeebeeeeeeeeebbbbeeeeeeeeeeebbbbeebbbbbeebbe:    
Contact         :  g                                      f                                                          
Contact         :                                         g                                                          

queryA      5826:RNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKVGILCIMSDRDLYDKLQFTSLEIP:5917
                :********************************************************************************************:
5rmk_B_1     502:RNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKVGILCIMSDRDLYDKLQFTSLEIP: 593
SecStr          :H GGGGG EEEES HHHHHHHHHHH   EEEHHHHTT  EEEEEEE    STTTT HHHHHHHHTTEEEEEEEEES HHHHHH  SEE    :    
ExpBur          :eeeebeebbbbbbbbbbbebbeeebebeeebbeebbeeeeebbbbbbbbeeeebeeebbbbbbbbbbeebbbbbbbbeebbeebebeeeeee:    
Contact         :                                    g             bb  b          g                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123