#WARNING:no index is registered index "YP_009724389.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009724389.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein. [pdbjlvh2]Protein Model on 7r2v assembly_id=1

Protein Model on 7r2v assembly_id=1 (TEMPLATE: 7r2v assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [440 aa] Proofreading exoribonuclease nsp14 :R1AB_SARS2
2 b C 1 (A) non-polymer(SAH) S-ADENOSYL-L-HOMOCYSTEINE 6217W 6235R 6238Q 6258G 6260P 6277D 6278A 6291L 6292F 6293Y 6310W 6311N 6312C 6314V 6351F (identity: 100.0 %/87.6 %)
3 c D 1 (A) non-polymer(PEG) DI(HYDROXYETHYL)ETHER 6311N 6345Y 6351F 6353T (identity: 100.0 %/87.6 %)
4 d E 1 (A) non-polymer(TRS) 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 6133C 6149Y (identity: 100.0 %/87.6 %)
5 e F 1 (A) non-polymer(ZN) ZINC ION 6377C 6402C 6409C 6412H (identity: 100.0 %/87.6 %)
6 f G 1 (A) non-polymer(ZN) ZINC ION 6132C 6135C 6151C 6154H (identity: 100.0 %/87.6 %)
7 g H 1 (A) non-polymer(ZN) ZINC ION 6182H 6186C 6189H 6204C (identity: 100.0 %/87.6 %)
8 h I 1 (A) non-polymer(ZN) ZINC ION 6037S 6203R (identity: 100.0 %/87.6 %)
9 i J 1 (A) non-polymer(ZN) ZINC ION 6368P 6369F 6370F 6419Y (identity: 100.0 %/87.6 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:7r2v_A_1 identity=87.6%
queryA      5950:THLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTGY:6049
                :***************     ********************************************* *            *******************  :
7r2v_A_1      25:THLSVDTKFKTEGLCXXXXXIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFAVAXXXXXXXXXXXNLPLQLGFSTGVNLVAVPTXX: 124
SecStr          :    TTSEE  TT  -----  SSEEHHHHHHHHT     GGGT S SB  HHHHHHTGGGEEEEEE -----------   EEEEETTTEEEEEE  --:    
ExpBur          :eebebeeebebeeee-----eeeebebeebbeebebebebeeeebbbbbbeeeebbeebbbbbbbbbe-----------eeeebbbbeeeeebebeee--:    
Contact         :                                                                                       h            

queryA      6050:VDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTY:6149
                :                              **********************************************************************:
7r2v_A_1     125:XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTY: 224
SecStr          :------------------------------  EEHHHHHHHHHHHHHHHHTTT SS EEEE   SHHHHHGGGTEE  S  B SSSSSB  EEETTTTEE:    
ExpBur          :------------------------------eeeebeebbeebbebbbeebeebbebbbbbbbbebebbebbeebbebbeeeebeebeebbbbbbeeeeeb:    
Contact         :                                                                                  fd f             d

queryA      6150:ACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDELKINAACRKVQHMVVKAALLAD:6249
                :****************************************************************************************************:
7r2v_A_1     225:ACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDELKINAACRKVQHMVVKAALLAD: 324
SecStr          :E SSS TT  EEES EEEEGGGG   S HHHHHHTT SSS   SSHHHHHHHHHHHHHHHHTTT   TT      SSHHHHHHHHHHHHHHHHHHHHHHH:    
ExpBur          :bbbeebeebbbbbbbbbbbbbbeebeeebeebbeeebeeeeeeeebbbebebbbbbbbbebbeeeeeeebebeeeeebeebeebbeebbebbbebbbebe:    
Contact         : f  f                           g   g  g             hg            b                 b  b           

queryA      6250:KFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKH:6349
                :****************************************************************************************************:
7r2v_A_1     325:KFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKH: 424
SecStr          :  SEEEEET TT   SSSS  SEEEEEESS  GGGTTSEEE    HHHHTTS  SSEEEEES   SS  SSEEEEEE TTS  SSEEE GGG EEEESSS:    
ExpBur          :ebebbbbbebbebeebbeeeebebebbbeebbeeeeeebeebebbeeebeeebeebbbbbbebebeebbebbbbbbbebeeeeebbbebbeebbbbbbeb:    
Contact         :        b b                bb            bbb                bbb b                              c    
Contact         :                                                             c                                      

queryA      6350:AFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFT:6449
                :*****************************            ***********************************************************:
7r2v_A_1     425:AFHTPAFDKSAFVNLKQLPFFYYSDSPCEXXXXXXXXXXXXVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFT: 524
SecStr          :EEEE    GGGGTTEEE    EE  S   ------------     TTEESHHHHHSS  HHHHHHHHHHHHHHHHHHHHTEEEEEETT  THHHHHTT :    
ExpBur          :beebeebeeebbeebeebebbbbbeeeee------------eebebeebbbebbeeeebbeebbeebeebeebbeebeebbbbbebbeebeeeebeeebe:    
Contact         : b c              iii      e                        e      e  e      i                              
Contact         : c                                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123