#WARNING:no index is registered index "YP_009724389.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009724389.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein. [pdbjlvh2]Protein Model on 7llf assembly_id=1

Protein Model on 7llf assembly_id=1 (TEMPLATE: 7llf assembly_id:1 )

CurrentView:HTML5 Change to:[JAVA] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [316 aa] Non-structural protein 3 :R1A_SARS2
2 b C 1 (A) non-polymer(ZN) ZINC ION 1752C 1754T 1755C 1787C 1789C (identity: 100.0 %/100.0 %)
3 c D 1 (A) non-polymer(SO4) SULFATE ION 1636H 1691N 1692P 1737Q 1738H (identity: 100.0 %/100.0 %)
4 d E 1 (A) non-polymer(BO3) BORIC ACID 1687E 1870E 1871N (identity: 100.0 %/100.0 %)
5 e F 1 (A) non-polymer(BO3) BORIC ACID 1622P 1631A 1637T 1638T 1639D 1642F 1643L (identity: 100.0 %/100.0 %)
6 f G 1 (A) non-polymer(SO4) SULFATE ION 1610H 1611N 1612S (identity: 100.0 %/100.0 %)
7 g H 1 (A) non-polymer(SO4) SULFATE ION 1703R (identity: 100.0 %/100.0 %)
8 h I 1 (A) non-polymer(Y54) 5-[(azetidin-3-yl)amino]-N-[(1R)-1-{3-[5-({[(1R,3S)-3-hydroxycyclopentyl]amino}methyl)thiophen-2-yl]phenyl}ethyl]-2-methylbenzamide 1725L 1726G 1727D 1730E 1811P 1827Y 1829G 1831Y 1832Q 1836Y 1864T (identity: 100.0 %/100.0 %)
9 i J 1 (A) non-polymer(SO4) SULFATE ION 1828T 1829G 1862P (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:7llf_A_1 identity=100.0%
queryA      1564:EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNG:1663
                :****************************************************************************************************:
7llf_A_1       2:EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNG: 101
SecStr          :   EEEEEEESSSSS EEEEEESSS HHHHHSSEEETTEE TT    STTTT EEEE   SHHHHHHHHHHHS   TTHHHHHHHHHHHHTTS   EETT:    
ExpBur          :eeeebebebbbbeeeeeeeebbbeebbeeebeebbbebeebbeeebeeebeeeebbbeeeeeebeebbeebbeeeeeebbeebbebbeebeebebeebee:    
Contact         :                                              fff         e        e    ceee  ee                    

queryA      1664:LTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLK:1763
                :****************************************************************************************************:
7llf_A_1     102:LTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLK: 201
SecStr          :EE     TTTHHHHHHHHHHTTS   BSSHHHHHHHHHHHTT  HHHHHHHHHHTT  TT    HHHHHHHHHHTB  TT EEEEEEEETTTEEEEEEEE:    
ExpBur          :bbbbeeeeebbbbbbbbbbbbbbebebebebbeebbeebeeeebbebbbbbbbbbebebeebbebeebbeebbeebebeebebbbbeebeeeeeeeeeee:    
Contact         :                       d   cc          g                     hhh  h      cc             b bb        

queryA      1764:GVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI:1863
                :****************************************************************************************************:
7llf_A_1     202:GVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPI: 301
SecStr          :THHHHEEES S HHHHHH EEEE SSSSEEEEEEEEEESSEEEEEEEEEEEEEETTS SEEEEEESSTTS EEEEEEESSSEEEEETTEEEEESEEEEEE:    
ExpBur          :bbebbbbeebbebeebbebbebeeeeeeebeebbbebebebbbbbbeeeeeebeeeebbbbbbbeeeeeeeebebbbbeebbbbbebeeeeeeeebebeb:    
Contact         :                       b b                     h               hih hh   h                         i 
Contact         :                                                                 i                                  

queryA      1864:TDVFYKENSYTTTIK:1878
                :***************:
7llf_A_1     302:TDVFYKENSYTTTIK: 316
SecStr          :EEEEEE SEEE    :    
ExpBur          :bbbbbeeeebebeee:    
Contact         :h     dd                                                                                            


Input Residue Numbers for Focused Sites

ex) 2,15,123