#WARNING:no index is registered index "YP_009724389.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009724389.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein. [pdbjlvh2]Protein Model on 7ed5 assembly_id=1

Protein Model on 7ed5 assembly_id=1 (TEMPLATE: 7ed5 assembly_id:1 )

CurrentView:JAVA Change to:[HTML5] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [926 aa] RNA-directed RNA polymerase :R1AB_SARS2
2 b B 1 (B) polymer(polypeptide(L)) [150 aa] Non-structural protein 8 :R1AB_SARS2 4661D 4662L 4663L 4664K 4665Y 4715P 4716T 4718F 4720P 4721L 4722V 4723R 4724K 4730V 4732F 4733V 4757R 4760F 4763L 4766Y 4767A 4770P 4771A 4772M 4773H 4774A 4775A 4776S 4777G 4778N 4779L 4780L 4781L 4782D 4783K 4784R 4788F 4790V 4792A 4794T 4795N 4796N 4797V 4799F 4839N 4901W 4906L 4907Y 4909D 4910S 4915D 5058M (identity: 100.0 %/100.0 %)
3 c C 1 (C) polymer(polypeptide(L)) [72 aa] Non-structural protein 7 :R1AB_SARS2 4801T 4802V 4803K 4804P 4805G 4807F 4812Y 4821F 4828E 4829L 4832F 4833F 4834F 4835A 4836Q 4837D 4944N 5235F (identity: 100.0 %/100.0 %)
4 d D 1 (D) polymer(polypeptide(L)) [154 aa] Non-structural protein 8 :R1AB_SARS2 4807F 4809K 4813D 5239I 5240V 5243D 5245T 5246L 5287L 5290H 5291M 5294M 5295Y 5297V 5298M 5299L 5300T (identity: 100.0 %/100.0 %)
5 e E 1 (I) polymer(polyribonucleotide) RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP*AP*AP*GP*UP*UP*AP*U*(AT9))-3') 4905R 5205C 5206S 5207Q 5228R 5232A 5241K 5249E 5250R 5253S 5254L 5257D (identity: 100.0 %/100.0 %)
6 f F 1 (J) polymer(polyribonucleotide) RNA (5'-R(P*CP*CP*CP*CP*AP*UP*AP*AP*CP*UP*UP*AP*AP*UP*CP*UP*CP*AP*CP*AP*UP*AP*GP*C)-3') 4800Q 4888N 4892K 4893S 4899N 4935N 4949V 4950A 4951G 4961R 4969K 4972A 4982G 4984S 4986F 4987Y 5074S 5075G 5076D 5077A 5081Y 5249E 5256I 5303N 5306R 5307Y 5312F 5316M (identity: 100.0 %/100.0 %)
7 g G 1 (A) non-polymer(ZN) ZINC ION 4687H 4693C 4698C 4702C (identity: 100.0 %/100.0 %)
8 h H 1 (A) non-polymer(ZN) ZINC ION 4879C 4963F 5034H 5037C 5038C (identity: 100.0 %/100.0 %)
9 i I 1 (A) non-polymer(MG) MAGNESIUM ION 4601N 4610D (identity: 100.0 %/100.0 %)
10 j J 1 (A) non-polymer(AT9) [[(2R,3R,4R,5R)-5-(2-azanyl-6-oxidanylidene-1H-purin-9-yl)-4-fluoranyl-4-methyl-3-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate 4423V 4425R 4427F 4442K 4445C 4447R 4463V 4465K 4508R 4511L 4512T 4513K 4515T 4600D 4609Y 4610D (identity: 100.0 %/100.0 %)
11 k K 1 (A) non-polymer(AT9) [[(2R,3R,4R,5R)-5-(2-azanyl-6-oxidanylidene-1H-purin-9-yl)-4-fluoranyl-4-methyl-3-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate 4937K 4945R 5012P 5013K 5014C 5015D 5074S 5079T 5083N 5152D 5190K (identity: 100.0 %/100.0 %)
12 l L 1 (A) non-polymer(MG) MAGNESIUM ION 5010D 5011Y 5152D 5190K (identity: 100.0 %/100.0 %)
13 m M 1 (A) non-polymer(MG) MAGNESIUM ION 4610D (identity: 100.0 %/100.0 %)
14 n N 1 (I) non-polymer(AT9) [[(2R,3R,4R,5R)-5-(2-azanyl-6-oxidanylidene-1H-purin-9-yl)-4-fluoranyl-4-methyl-3-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate 5150L 5151S 5152D 5153D 5205C 5206S (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:7ed5_A_1 identity=100.0%
queryA      4396:AQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFK:4495
                :****************************************************************************************************:
7ed5_A_1      28:AQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFK: 127
SecStr          : HHHHHHHS SS  EEEESSSTTS   EEEEEEEE SS EEEEEEEE   B EEEE TTS EEEEEEEEEE  HHHHHHHHHHHHHTTT TTB EEEEEE:    
ExpBur          :eeebbeebbeeeebebeeeeeeeeebebebbbbeeeeebbbbbbbeeeebbbbbbbeeeeeeeebbbbbbbeeeebbeebeebbeebeebebbbebebbe:    
Contact         :                           j j j              j  j j               j j                              

queryA      4496:FRIDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAMRNAGIVG:4595
                :****************************************************************************************************:
7ed5_A_1     128:FRIDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAMRNAGIVG: 227
SecStr          :EESSSSEEEEEEEEEE SSBHHHHHHHHHS  SSS HHHHHHHHTTTS  S GGGSTTSS SSSSGGGSTTTGGGHHHHHHHHHHHHHHHHHHHHHTEE :    
ExpBur          :beeeeeeebbbbbbebbbbbbbbbbbbbbbbeeeebebbeebbeebebbeeebbeeeebbbbbeeeebeebbbebbeebbebbbebbebbebbeeebbeb:    
Contact         :            j  jjj j                                                                                

queryA      4596:VLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVNCLD:4695
                :****************************************************************************************************:
7ed5_A_1     228:VLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVNCLD: 327
SecStr          :B  GGGBBTTS B   TT EE STT    B HHHHHHHHHHHHHTTGGGGGGBTTS TTS B    SS    HHHHHHHHHHHSTT  S   SSGGG SS:    
ExpBur          :ebbbbbbbbebbbbebeebeeeeeeebebebbbbbbbbbbbbbbbebbebbbbeebeeeeeeeeeeeeeeebbebbeebbeebbebbebebbbbbeebee:    
Contact         :    ji       ji                                                  bbbbb                     g     g  
Contact         :              j                                                                                     
Contact         :              m                                                                                     

queryA      4696:DRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTN:4795
                :****************************************************************************************************:
7ed5_A_1     328:DRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTN: 427
SecStr          :SHHHHHHHHHHHHHTTTS GGGSEEEEE  EETTEE  EEEEEE SSS EE  S   SEES   HHHHHHHHHSHHHHHHTSEE   TT SS EEEESSS:    
ExpBur          :bebbbbbbbbbbbbbebbeeebbbebeeebebeeeeeebbbbbbbebbbbbebeeeeeebeebeeeeebbbebbbbebbeeeeebebeebebebebbeee:    
Contact         :  g   g            bb b bbbbb     b bb                       b  b  b  bb  bbbbbbbbbbbbbbb   b b b bb

queryA      4796:NVAFQTVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAG:4895
                :****************************************************************************************************:
7ed5_A_1     428:NVAFQTVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAG: 527
SecStr          :S     B   EE HHHHHHHHHTT S TT S     B   B STTHHHHHTTGGG       HHHHHHHHHHHHHHT S       GGG   SSS S   :    
ExpBur          :eeeeeebeeebebeebeebbeeeebbeeebebeeebebeeeeeebbbebbbebebbbebbbbbbbbbbbbbbbbebbeebeebbbebeebeeeeeeeebb:    
Contact         :bb bfccccc c d  cd       c      cc  cccccc b                                       h        f   ff  
Contact         :           d                                                                                        

queryA      4896:FPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHNMLK:4995
                :****************************************************************************************************:
7ed5_A_1     528:FPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHNMLK: 627
SecStr          :TTGGGT  HHHHHHHS HHHHHHHHHHHTTS    EEEEEE    BSSS   EEEE  HHHHHHHHHHHSSSSSSSTT  SSS  TT  STTTHHHHHHH:    
ExpBur          :bbbeeeeebeebbeebeeeebeebbebbbebbbbbbbebebeeebbeeeebebebbbbbbbbbbbebbbbebbebbeeeeebbbbbeeebeebbbbebbe:    
Contact         :   f b   ebb bb    b                   f k      ck   fff         f h     f  f         f f ff        

queryA      4996:TVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTAN:5095
                :****************************************************************************************************:
7ed5_A_1     628:TVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTAN: 727
SecStr          :HHHTT SSEEEEEE  TTTTTS  HHHHHHHHHHHTSTTTTTS HHHHHHHHHHHHHHHTS EEEETTEEE   S   TTSS HHHHHHHHHHTTTHHHH:    
ExpBur          :ebbeebeeeebbbbebbebbbbbbbbbbbbbbbbbbbbbeeebeeeebbbbbbbbbbbbbebbbbbebbbbebebbbbeebebbebbbbbbbbbbbbbbb:    
Contact         :              llkkkk                  h  hh                   b               ffff k f k            
Contact         :                                                                              k                     

queryA      5096:VNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMMILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTET:5195
                :****************************************************************************************************:
7ed5_A_1     728:VNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMMILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTET: 827
SecStr          :HHHHTTS GGG   HHHHHHHHHHHHHHHT  S  HHHHHTTHHHHHHHEEE  BTTBEEEEEEHHHHHTTSS  HHHHHHHHHHHSS    GGG EEES:    
ExpBur          :bbbbbbbbbeebeeeebbebbbebbebbbeeeeebeebbeebbebbeebbbbbbeeebbbbbbbbebbeeebbbbbebbbbbbbbbbbbbbeeeebbebe:    
Contact         :                                                      nnkn                                    k     
Contact         :                                                        l                                     l     
Contact         :                                                        n                                           

queryA      5196:DLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDMY:5295
                :****************************************************************************************************:
7ed5_A_1     828:DLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDMY: 927
SecStr          : SSS  S BTTBEEEEEEETTEEEEEEE  HHHHHHHHHEESSSTTT STT STTHHHHHHHTGGGGGSSSHHHHHHHHHHHHHHHHHHHHHHHHHHHH :    
ExpBur          :ebeebbeebeebebbebebeeeebbbbbbebbebbbbbbbbeeeeebebbebbebbbebbbebbbbeebeeeeebebbebbbebbeebbeebbeeeeeee:    
Contact         :         eee                    e   e  c   dde d dd  ee  ee fe                             d  dd  dd
Contact         :         nn                                          f                                              

queryA      5296:SVMLTNDNTSRYWEPEFYEAMYTPHT:5321
                :**************************:
7ed5_A_1     928:SVMLTNDNTSRYWEPEFYEAMYTPHT: 953
SecStr          :S     SSSGGGGSHHHHHTTSSS  :    
ExpBur          :eeeeeeeebeeebeeeebeebbeeee:    
Contact         : dddd  f  ff    f   f                                                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123